KEGG   Bos taurus (cow): 516328Help
Entry
516328            CDS       T01008                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    516328 (USP1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     516328 (USP1)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   516328 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 783 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKTSEYKGSEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVEDLSTKVEEYQKEE
MSDNNSMEMDNMRHSEDYKEKLSKGNGKRKSDAEFGNMKKKVKISKEHQSSEENQRQTRS
KRKAAGDTLEISHKIIPKHISENESTRPSQRKSKVKINWLKSAAKQPSILSKFCSMGKIA
TNQGSKGHCKENEYDLEEDLGKYENDNTTNDCELESPGNNDMPVHVNEVKPINKGAEQIG
FELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEENSEISPEPKTEM
KTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEF
DCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTD
LNSLELDKENFVIDQTCEIGKPEPLNEEEVRGVVENYDNEEVSIRVSGNNQPSKVLNKKN
VEAIGLLGGQKSKADYELYNKASNPDKVASTALPENRNSETNNTNGTDESDSNKESSDQT
GINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLFY
KKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatgggctttcaagaggtagtccatcaaaaaaa
aacagactttccttgaagttttttcagaaaaaggaaaccaagagagccttggatttcaca
gattctcaagaaaatgaagaaaagacttctgaatataaagggtctgaaattgatcaagtt
gttcctgcggcacagtcctcgcctataaactgtgagaagagagaaaacttgctaccattt
gtgggactgaataatctcggcaatacttgttatcttaatagtatacttcaggtattatat
ttttgtcctggttttaaatctggagtgaagcacttatttaatattatttcaaggaagaaa
gaagccctaaaagatgaagccaatcaaaaagataagggaaactgcaaagaagattctttg
gcaagttatgaactaatatgcagcttacagtccttgatcatttcagttgaacagcttcag
gctagttttctattaaatccagaaaagtacactgatgaacttgctactcagccaaggcga
ctacttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtagaagacttatctactaaggtagaagaatatcagaaagaggaa
atgagtgataataacagcatggagatggacaatatgaggcattctgaagactataaagaa
aaactctcaaaaggaaatgggaaaagaaaaagtgatgctgaatttggtaacatgaaaaaa
aaagttaaaatctccaaggaacaccagtcttcggaagaaaaccagagacaaaccagatca
aaaagaaaagctgcaggtgatacattagagatttctcataaaataatccccaagcacatt
tctgaaaatgagagtacaagaccctcccaaaggaaatcaaaagttaaaataaattggtta
aagtctgcagctaagcaacccagcattctttccaagttctgtagtatgggtaaaatagca
acaaaccaaggatccaaaggacactgtaaagaaaatgaatatgatcttgaagaggacttg
gggaagtatgaaaatgataatacaactaatgattgtgaacttgagtctccaggaaataat
gatatgcccgttcatgttaatgaagttaagcccataaacaaaggtgcagagcaaattggt
tttgagctagtggagaaattatttcaaggtcagctggtattacggactcgttgcttagaa
tgtgaaagtttaacagaaagaagagaagattttcaagacatcagtgtaccagtgcaagaa
gatgagctttccaaagtagaggagaattctgaaatttctccagagccaaaaacagaaatg
aagaccctgagatgggcaatttcacaatttgcttcagtggaaaggattgtaggagaagat
aaatatttctgtgaaaactgccatcattatactgaagcggaacgaagtcttttgtttgac
aaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggcttggagttt
gactgttatggtggtggactttccaagatcaacactcctttactgacacctcttaaattg
tcactagaagaatggagcacaaagccaaccaacgacagctatggattatttgcagttgtg
atgcacagtggcattacaattagtagtgggcactatactgcttctgttaaagtcactgac
cttaacagtttagaactagataaggaaaattttgtgatcgaccaaacgtgtgaaataggt
aagccagaaccattgaatgaggaggaagtaaggggtgtggttgaaaattatgacaatgaa
gaagtgtctattagagtcagtggaaataaccagccaagtaaagttttgaacaaaaaaaat
gtagaagctattggacttcttggaggacaaaagagcaaggcagattacgagttatacaac
aaagcgtctaaccctgataaagttgccagtacagcacttcctgaaaatagaaattctgag
actaacaatactaatgggaccgatgaatctgatagtaacaaggaatccagtgaccaaaca
ggcattaacattagtggttttgagaacaaaatttcatatgtagtgcaaagcttaaaggag
tatgaggggaaatggttgctttttgatgattctgaagtgaaagttactgaagagaaggac
tttttgaattctctttccccttctacatctcctacatctactccttacttgctattttat
aagaaattatag

DBGET integrated database retrieval system