KEGG   Bos taurus (cow): 516420Help
Entry
516420            CDS       T01008                                 

Gene name
USP46
Definition
ubiquitin specific peptidase 46 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     516420 (USP46)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   516420 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 366 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNET
RCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQK
RMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVA
VVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYIL
FYQSRE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgaaacatcgcctccatctgtaatatgggcaccaatgcctctgctctggaa
aaagacattggtccagagcagtttccgatcaatgaacactacttcggattggtcaacttc
ggaaacacatgctactgtaactccgttcttcaggccctgtacttctgccggccgttccgg
gagaacgtgctggcgtacaaggcccagcaaaaaaagaaagagaacttgttgacatgcctg
gcagaccttttccacagcatcgccacgcagaagaagaaggtcggcgtgatcccaccaaag
aagttcatttcgaggctgagaaaagaaaatgatctctttgataactacatgcagcaggac
gcccacgaatttttaaattatttgctaaacactattgcggacatcctgcaggaagagaag
aaacaggagaaacaaaatggaaaattaaaaaatggcaacatgaatgaacctgcagagaat
aataaaccagaactcacctgggtccatgagatttttcagggaacgctcaccaatgaaact
cgatgcttgaactgtgaaactgttagcagcaaagatgaagattttcttgacctttctgtt
gatgtggagcagaacacatctattacccactgtctaagagatttcagcaacacagaaaca
ctgtgtagtgaacagaagtattattgtgaaacatgctgcagcaaacaggaggcccagaaa
aggatgagagtcaaaaagctgcccatgattttggccctgcacctcaagcggttcaagtac
atggagcagctccataggtacaccaagctctcttaccgagtggtcttcccactggaactc
cggctcttcaacacctccagtgatgcagtaaacctggaccgcatgtacgacctggtcgcg
gtggtggtacactgcggcagtggtcctaatcgtgggcattatattactattgtgaaaagt
catggcttctggcttttgtttgacgacgacattgtagagaaaatagatgcccaagctatt
gaagaattctatggcctgacatcagatatatcaaaaaattcagaatctggatatatttta
ttctatcagtcaagagaataa

DBGET integrated database retrieval system