KEGG   Bos taurus (cow): 516422Help
Entry
516422            CDS       T01008                                 

Gene name
ADRA2B
Definition
adrenergic, alpha-2B-, receptor
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
bta  Bos taurus (cow)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    516422 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    516422 (ADRA2B)
G protein-coupled receptors [BR:bta04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    516422 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 447 aa AA seqDB search
MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKFIILIVWLIAAVISLPPLIYKGDQGPQPLARPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSHCRGPRAKGGPGERESKQPHPVPGEVSDSAKLPTLASQ
LATPGEANGCSQPRPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQKEGVCGSSPEEEAE
EEEEEGCEPQALPASPASACSPPLQQPQGSRVLATLRGQVLLGRGTGTAGAQWWRRRTQL
SREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNP
VIYTVFNQDFRRAFRRILCREWTQTAW
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggagccctactcggtgcaggccactgcggccatcgcggcggtcatcacc
ttcctcatcctcttcaccatcttcggcaacgcgctggtcatcttggctgtgctgaccagc
cgctcgctgcgcgccccgcagaacctgttcctagtgtcgctggccgccgccgacatcctg
gtagccacgctcatcatccctttctcgctggccaacgagttgctgggctactggtacttc
tggcgcacctggtgcgaggtgtacctggcgctcgacgtgctcttctgcacttcctccatc
gtgcacctgtgtgccatcagcctggaccgctactgggcagtgagccgggccctggagtac
aactccaagcgcaccccgcgccgcatcaagttcatcatcctcatcgtatggctcatcgca
gcggttatctcgctgccgcccctcatctacaagggcgaccagggtccccagcccctggcc
cgccctcagtgcaagctcaaccaagaggcctggtatattcttgcctccagcattggatct
ttctttgcaccctgccttatcatgatcctggtctacctgcgcatctacctgattgccaag
cgcagccactgcagaggccccagggccaaaggggggcctggggagagggagtctaagcag
ccacaccctgtccctggggaagtttcagactcagccaaactgccaaccttggcctctcaa
ctggctactcctggagaggccaacggatgctcccaacctcgcccaggggagaagggtgac
ggggagacccctgaagcccctggcactcctgccttgccacccagctggcctgccatcccc
aagtcaggccagggtcagaaggaaggggtctgtggttcatctccggaggaggaggcagaa
gaggaggaagaagagggttgtgagccgcaggccttgccggcgtctcctgcctcagcttgc
agcccgcccctgcagcagccacagggttcccgggtgctggcaaccctgcgtggccaggtg
ctcctgggcaggggcacaggcactgcaggggcgcagtggtggcggcggcggacgcagctg
agccgagagaagaggttcaccttcgtgctggctgtggtcatcggtgtcttcgtgctctgc
tggttccctttcttcttcagctacagcctgggtgccatctgcccgcagcactgcaaggtg
ccccacggcctcttccagttcttcttttggatcggctactgcaatagctcgctgaatccc
gtcatctacactgtcttcaaccaggactttcgccgtgccttccggaggatcctgtgccgc
gagtggacccagacagcctggtga

DBGET integrated database retrieval system