KEGG   Bos taurus (cow): 516797Help
Entry
516797            CDS       T01008                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    516797 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    516797 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    516797 (PPT2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     516797 (PPT2)
Lipid biosynthesis proteins [BR:bta01004]
 Fatty acid synthase
  Component type
   516797 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 305 aa AA seqDB search
MLGLPERRLPSAEFLLLLPFLLLLLLLLPAAPAPHRAAYKPVIVVHGLFDSSYSFRHLLE
YINETHPGTAVTVLDLFDGRESLRPLWEQVQGFREAVAPIMAKALQGVHLICYSQGGLVC
RALLSVMDEHNVDSFISLSSPQMGQYGDTNYLKWLFPTSMRSNLYRICYSPWGQEFSICN
YWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRLGRLVLIGGPDDGVITPWQSS
FFGFYDANETVLEMEKQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCI
EPWLS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctggggctcccggaacggcggctcccttcggcggagttcctgctcctgttgccattc
ctgctgctgctgctgctgctgctgcccgccgcccccgcgccccatcgggctgcctacaag
ccggtcatagtggtgcacgggctctttgacagttcgtacagcttccgccacctgctggaa
tacatcaatgagacacaccctgggactgcggtgacagtgctcgatctcttcgatgggaga
gagagtttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtggcccccatc
atggcaaaggctcttcaaggggtgcacctcatctgctactcccaggggggcctggtgtgc
cgggcactcctgtctgtgatggatgaacacaatgtggattctttcatctctctctcctct
ccacagatgggacagtatggagacacaaactatttgaagtggctgttccccacctccatg
aggtctaacctctaccggatctgctacagcccgtggggccaggaattctccatctgcaac
tactggcatgaccctcaccatgatgacttgtacctcaatgccagcagcttcctggccctg
atcaatggggaaagagaccatcccaatgccactgcttggcggaagaactttctgcgtttg
ggccgcctggtgctgattgggggccctgatgatggtgtcattactccctggcagtccagc
ttctttggtttctatgatgcaaatgagacagtcttggagatggagaagcaactggtttat
ctgcgggactcttttgggttgaagactctgcttgcccggggggccatagtgaggtgtcca
atggctgggatctcccacacggcctggcactccaaccgtaccctttatgagacctgcatt
gaaccttggctctcctga

DBGET integrated database retrieval system