KEGG   Bos taurus (cow): 516797Help
Entry
516797            CDS       T01008                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bta01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:bta00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 305 aa AA seqDB search
MLGLPERRLPSAEFLLLLPFLLLLLLLLPAAPAPHRAAYKPVIVVHGLFDSSYSFRHLLE
YINETHPGTAVTVLDLFDGRESLRPLWEQVQGFREAVAPIMAKALQGVHLICYSQGGLVC
RALLSVMDEHNVDSFISLSSPQMGQYGDTNYLKWLFPTSMRSNLYRICYSPWGQEFSICN
YWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRLGRLVLIGGPDDGVITPWQSS
FFGFYDANETVLEMEKQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCI
EPWLS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctggggctcccggaacggcggctcccttcggcggagttcctgctcctgttgccattc
ctgctgctgctgctgctgctgctgcccgccgcccccgcgccccatcgggctgcctacaag
ccggtcatagtggtgcacgggctctttgacagttcgtacagcttccgccacctgctggaa
tacatcaatgagacacaccctgggactgcggtgacagtgctcgatctcttcgatgggaga
gagagtttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtggcccccatc
atggcaaaggctcttcaaggggtgcacctcatctgctactcccaggggggcctggtgtgc
cgggcactcctgtctgtgatggatgaacacaatgtggattctttcatctctctctcctct
ccacagatgggacagtatggagacacaaactatttgaagtggctgttccccacctccatg
aggtctaacctctaccggatctgctacagcccgtggggccaggaattctccatctgcaac
tactggcatgaccctcaccatgatgacttgtacctcaatgccagcagcttcctggccctg
atcaatggggaaagagaccatcccaatgccactgcttggcggaagaactttctgcgtttg
ggccgcctggtgctgattgggggccctgatgatggtgtcattactccctggcagtccagc
ttctttggtttctatgatgcaaatgagacagtcttggagatggagaagcaactggtttat
ctgcgggactcttttgggttgaagactctgcttgcccggggggccatagtgaggtgtcca
atggctgggatctcccacacggcctggcactccaaccgtaccctttatgagacctgcatt
gaaccttggctctcctga

DBGET integrated database retrieval system