KEGG   Bos taurus (cow): 516797Help
Entry
516797            CDS       T01008                                 

Gene name
PPT2
Definition
(RefSeq) palmitoyl-protein thioesterase 2
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bta  Bos taurus (cow)
Pathway
bta00062  Fatty acid elongation
bta01100  Metabolic pathways
bta01212  Fatty acid metabolism
bta04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    516797 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    516797 (PPT2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     516797 (PPT2)
Lipid biosynthesis proteins [BR:bta01004]
 Fatty acid synthase
  Component type
   516797 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 DUF676 Abhydrolase_6 Lipase_2 PGAP1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 516797
NCBI-ProteinID: NP_001030395
Ensembl: ENSBTAG00000004436
UniProt: Q1JQA0
Position
23
AA seq 305 aa AA seqDB search
MLGLPERRLPSAEFLLLLPFLLLLLLLLPAAPAPHRAAYKPVIVVHGLFDSSYSFRHLLE
YINETHPGTAVTVLDLFDGRESLRPLWEQVQGFREAVAPIMAKALQGVHLICYSQGGLVC
RALLSVMDEHNVDSFISLSSPQMGQYGDTNYLKWLFPTSMRSNLYRICYSPWGQEFSICN
YWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRLGRLVLIGGPDDGVITPWQSS
FFGFYDANETVLEMEKQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCI
EPWLS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctggggctcccggaacggcggctcccttcggcggagttcctgctcctgttgccattc
ctgctgctgctgctgctgctgctgcccgccgcccccgcgccccatcgggctgcctacaag
ccggtcatagtggtgcacgggctctttgacagttcgtacagcttccgccacctgctggaa
tacatcaatgagacacaccctgggactgcggtgacagtgctcgatctcttcgatgggaga
gagagtttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtggcccccatc
atggcaaaggctcttcaaggggtgcacctcatctgctactcccaggggggcctggtgtgc
cgggcactcctgtctgtgatggatgaacacaatgtggattctttcatctctctctcctct
ccacagatgggacagtatggagacacaaactatttgaagtggctgttccccacctccatg
aggtctaacctctaccggatctgctacagcccgtggggccaggaattctccatctgcaac
tactggcatgaccctcaccatgatgacttgtacctcaatgccagcagcttcctggccctg
atcaatggggaaagagaccatcccaatgccactgcttggcggaagaactttctgcgtttg
ggccgcctggtgctgattgggggccctgatgatggtgtcattactccctggcagtccagc
ttctttggtttctatgatgcaaatgagacagtcttggagatggagaagcaactggtttat
ctgcgggactcttttgggttgaagactctgcttgcccggggggccatagtgaggtgtcca
atggctgggatctcccacacggcctggcactccaaccgtaccctttatgagacctgcatt
gaaccttggctctcctga

DBGET integrated database retrieval system