KEGG   Bos taurus (cow): 517349Help
Entry
517349            CDS       T01008                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
23
AA seq 603 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWYCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TRHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQTQDPPLRRGRTLRSM
AAGEDAVPPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKTSRGQAKLEQQRREEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHTPRTAPLRVPAPRAPAGPRPAPRRAP
AMAPGVTGLRNLGNTCYMNSILQVLSHLRKFRECFLNLDPSKTEQLFPRAANGKAPLSGR
PASSSATELSSTRSDGAEACEREGLCLNGGTSLSRSLELIQNKEPSSKHISLCHELHTLF
RVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTRRIL
IPFSQRKLTKQVLKVVNTIFHGQLLSQVTCVSCNYKSNTIEPFWDLSLEFPERYHCIEKG
FVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRL
PQVLRLHLKRFRWSGRNHREKIGVHVVFDQWSCITGKGLAQDTTQPIATIQREVFGSTAM
TQS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttgcggctcgcccaggaccactccatcctgaac
ccgcagaagtggtactgccgggagtgcgccaccaccgagtcggtgtgggcttgtctcaag
tgctcgcacgtggcctgcggccgctacatcgaagatcatgccctcaaacacttcgaagag
accagacacccgctagccatggaggtccgggatctctacgtgttctgctacctgtgcaag
gactacgtgcttaacgacaacccggagggggacctgaagctgctgagaagctccctcctg
gcggtcaggggccagacgcaggacccgccgctgaggcgcgggcggacgctgcggtccatg
gcggcgggcgaggacgcagtcccgccgcagcgcgctccccagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcctgctggccaggacgctgcggctctggttcgag
aagacctcgcggggccaggccaagctggagcagcagcggcgggaagaggcgctggagcgc
aagaaggaggcggcgcggcagcggcggcgcgaagtgaagcgacgactgctggaggagctg
gccagcgcccccccgcgcaaaagcgcgcgcctgctgctgcacacgccccgcaccgcaccg
ctgcgcgtgcccgccccgcgcgcgcccgccgggccccgccctgcgccgcgccgcgcgccc
gccatggcgcccggcgtcacgggcctgcgcaacctgggcaacacctgctatatgaactcc
atcctgcaggtgctcagccacctgcgcaagttccgcgagtgctttctgaacctcgacccg
tccaagacggagcagctgttccccagggccgccaacggcaaggccccgctctcaggcagg
ccagccagcagctcggccacagagctgtcgtcgacccggagtgatggggccgaggcctgc
gagcgcgagggcctctgcttgaacggtgggacctccctcagcaggagcctagagctcatc
cagaacaaggagcccagctcgaagcacatctccctctgccacgaactgcacaccctcttt
cgcgtcatgtggtcgggaaagtgggccctggtgtcgcccttcgccatgcttcactcggtg
tggagcctgatccctgccttccgcggctacgaccagcaggacgcgcaggagtttctctgc
gagcttttgcacaaagtgcagcaggaactcgagtccgaaggcacgacgcgccggatcctc
atccccttctcccagaggaagctcaccaaacaggtcttaaaggtggtgaacaccatattt
cacgggcagctacttagccaggtcacttgtgtatcatgcaattacaaatccaataccatt
gagcccttttgggatctgtccctggagttccctgaacgctatcactgcatagaaaagggt
tttgtccctttgaatcagacagagtgcctgctcactgagatgctggcaaagttcacagag
acagaggccctggaaggcagaatctacgcttgtgaccagtgtaacagcaaacgacgaaaa
tccaatccaaaaccccttgttctgagtgaagctagaaagcagttaatgatctacagacta
cctcaggtcctccggctgcaccttaaaagattcaggtggtctggccgtaatcaccgagag
aagattggggtccatgtcgtctttgaccagtggtcatgcatcacgggaaagggtttggct
caggacactacacagcctattgctacaatacagagggaggtttttgggtccactgcaatg
actcaaagctga

DBGET integrated database retrieval system