KEGG   Bos taurus (cow): 517559Help
Entry
517559            CDS       T01008                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    517559 (HDAC4)
  Substance dependence
   05034 Alcoholism
    517559 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    517559 (HDAC4)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     517559 (HDAC4)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     517559 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1122 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLP
VAEPGLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPA
TGPSTGAAGQQEAERLALPALQQRISLFPGTHLAPYLGAAPLERDAGAAPGSLLQHVVLL
EQPPTQTPLVTDRYLAGLGALPLHAQPLVGAERVAPSVHKLRQHRPLGRTQSAPLPQSTQ
ALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKQPRPKGSCPEVCVPQSNIWMITPDLLSAA
SGTKMIPKPSEPARQPESHPEETEEELREHQALLEEPFLDRLPGQKEAHTLAGVQVKQEP
IESDDEETEPPREAEPGQRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFG
GHRPLSRAQSSPASATFPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRI
QSIWSRLQETGLRGKCECIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSKKLLGSL
TSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGH
HAEESTPMGFCYFNSVAIAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISL
HRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEF
APDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAIC
DASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSL
VEAQKCENEEAETVTAMASLSVAVKAPEKRPDEEPMEEEPPL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcaaagccatccagatggactttctggccgagaccagccggtggagctgctc
aaccctgcccgcgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcctctg
ccagtggcccccccgggggtgcccatggacctgcgcctggaccaccagtttccgctgccc
gtggcggagccgggcctccgcgagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagctgcagagacagatcctcatcgctgagttccagaggcagcacgagcagctg
tcgcggcagcacgaggcccagctgcacgagcacatcaagcaacagcaggagctgctggcc
atgaaacaccagcaggagctgctcgagcaccagcggaagctggagcggcaccggcaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctgaagaacaaggagaag
ggcaaagagagcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtcctc
aataaaaagaaggccctggctcaccggaacctgaaccactgcatgtccagcgaccctcgc
tactggtacgggaagacgcagcacagctcgctggaccagagctccccgccccagagcggg
gcgtcagcctcctacaaccacccagtcctgggcatgtatgacgccaaagacgacttcccc
ctcagaaagacagcttctgaacccaacctgaaattacgctccaggctaaagcagaaagtg
gctgagagacggagcagccccctgctacgcaggaaagatgggccagtggtcacggctctg
aaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgccccaggctccgcgccc
agctcgcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgccgtc
cccagcatcccagccgagaccagcctggcacacagactcgtggcacgagagggctcggtg
ggtccgctgcccctctacacgtcaccatccctgcccaacatcacactggggctgcccgcc
accggcccctccacgggggcggccggccagcaggaggccgagagactggccctccccgcc
ctgcagcagcgcatctccctcttccctggtacccacctcgccccctacctgggcgcagcg
cctctggagcgggacgcgggggcagccccgggctccctcttgcagcatgtggtcctcctg
gagcagccgcccacgcagacgcccctcgtcacagaccgctaccttgcaggcctgggcgcg
ctgcccctgcacgcgcagcccctggtaggggcggagcgagtggccccctcggtgcacaag
ctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctgccccagagcacgcag
gcgctgcagcacctggtcatccagcagcagcaccagcagttcctggagaagcacaagcag
cacttccagcagccgcagctgcacctcaacaagcaacctcggccaaagggctcctgccca
gaggtctgcgtccctcaatccaacatctggatgatcactcccgacctgctttcagcagca
agcggcaccaagatgatccccaaacccagcgagccggcccggcagcccgagagccacccc
gaggagacagaggaggagctgcgggagcaccaggcgctcctggaggagcccttcctggac
cggctcccagggcagaaggaggcccacacactggccggggtgcaggtgaagcaggagccc
atcgagagtgatgacgaggagacggagcccccgcgggaggcggagcccggccagcggccg
cccacagagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcggatc
caccagctgaggaactaccaggcgtccatggaggctgctggcatccccgtgtcctttggc
gggcaccggcccctgtcccgggcacagtcctcccccgcatccgccaccttccccatgtcc
gtgcaggagcccccagccaagccaaggttcaccacaggcctcgtgtacgacactctgatg
ctgaaacaccagtgcacctgcgggaacaccaacagccacccagagcacgccgggcgcatc
cagagcatctggtcgcggctgcaggagaccggcctgcgaggcaaatgtgagtgcatccgc
ggacgtaaggccacgctggaggagctgcagacagtgcactcggagacacacgccctgctg
tacggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcacta
acgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggacagtgacaccatatgg
aacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgtgtggtagagctggtc
ttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgccctccaggacac
cacgcagaggagagcacgcccatggggttctgctacttcaactccgtagccatcgctgcc
aagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtggactgggatgtgcac
catgggaacgggacccagcaggccttctatagcgacccccgcgtgctctacatctccctg
caccgctacgacgacggcaacttcttcccgggcagcggcgcgcctgacgaggtgggcacg
ggcgccggcgtgggctttaacgtcaacatggctttcaccggcggcctggacccccccatg
ggagacgcagagtacctcgcagccttcaggaccgtggtcatgccgatcgccagcgagttc
gccccggacgtggtgctggtgtcctcgggcttcgatgccgtggagggccaccccacgccc
ctcggaggctacaacctctccgccaagtgtttcgggtacctgacaaagcagctgatgggc
ctggccggcggccgggttgtcctggcgctggaggggggccacgatctcacagccatctgc
gacgcctcggaagcctgcgtctctgccctgctggggaatgagctcgatcctctcccagaa
aaggtcttacagcagagacccaatgccaacgctgtgcggtcgatggagaaggtcattgaa
atccacagccagtactggcgctccctgcagaggcttgcctccaccgctggctactcccta
gtcgaggcccagaagtgtgagaacgaggaagccgagactgttactgccatggcctcgctg
tctgtggcggtgaaggcccctgagaagagacccgacgaggagcccatggaagaggagccg
cctctgtag

DBGET integrated database retrieval system