KEGG   Bos taurus (cow): 517697Help
Entry
517697            CDS       T01008                                 

Gene name
ZNF280B, SUHW2
Definition
(RefSeq) zinc finger protein 280B
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4195 zf-C2H2_4 zf-Di19 zf-met zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 517697
NCBI-ProteinID: NP_001071403
BGD-bta: BT19643
Ensembl: ENSBTAG00000001005
UniProt: Q3T0N8
Position
17
AA seq 545 aa AA seqDB search
MEPPCMLCEENQEPEPQKSVGETKQVDDEDAELIFVGVEHVNEDADLIFVGMTSNSKPVV
SNILNRVTPGSCSRRKRYGHFRKDNAHKLQPVSHVTRTSEAKIVLPVSDSESRSTDSPII
IEPLSKPDYKNISPQIVPNSFSELCSPLITFTSSLQHPVETTVSAGDMNKSPRVSKRLST
SETNSTNPKRPKLSDGIIGEHSLALSPSGIFQQNFLTTQQSKPDSVHTSLSHVQNGEPCP
TAFAKDNVHCKPVSPLGENGLTKTDFPSLASQKKIVDPTEGNLIVLLRDFYYGQHIGDGQ
PEPKTHTAFKCLSCLKVLKNLKFMNHMKHHLELERQRGDSWKNHTTCQHCHRQFPTPFQL
QCHIESVHTSQEPSTVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCNYRSSVFADV
DAHFRAYHGNTKNLLCPFCLKIFKTATPYMCHYRGHWEKSFHQCSKCRLQFLTFKEKMEH
KTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNISDSEPSPPKSKSRS
SKKPC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaccatgtatgttatgtgaagaaaaccaagagccagaaccacagaaaagcgta
ggagaaaccaaacaagtagatgatgaagatgctgaactgatctttgttggagtggaacat
gtaaatgaagatgctgatctgatctttgttggaatgacctcaaattcaaaaccagtcgtt
tcaaacatattgaacagagttaccccaggttcatgttcaaggagaaaaaggtatggtcac
ttcaggaaagataatgctcacaaattacagcctgttagtcatgtgactcgtacatccgaa
gcaaagattgtcttgccagtttctgactctgaatcaagatcaacagatagtcctattatt
attgagcctttgtctaaacctgattataaaaatatttcaccacaaatagtgcctaatagc
ttttcagagttatgttctcctttgattaccttcacaagttcattgcagcatccagtagaa
acaacagtttctgcaggagatatgaataaaagtcctcgtgtatcaaagcgactttccact
tctgaaacaaatagcacaaatcccaaaaggcctaaactcagtgatggaattataggggaa
cattctttagctttgtccccttcaggtatttttcagcaaaattttttgactactcagcaa
agcaaaccagacagtgttcatacctcattaagccatgttcagaatggagaaccttgtcca
acagcttttgcaaaggacaatgttcattgcaagcctgtaagtcctttaggggaaaatgga
ctgacaaaaactgactttccaagtttagcaagtcaaaaaaagattgttgatcccacagaa
ggcaatctgatagtgttacttcgtgacttctactatggacagcatataggagatgggcag
ccagaaccgaagactcacacagcctttaaatgcctcagctgcttgaaagttctaaaaaat
ctcaagtttatgaatcacatgaagcaccatttggaacttgagaggcagagaggtgacagc
tggaaaaaccacaccacctgccagcactgccaccgccagtttcccaccccattccagctg
cagtgtcacattgaaagtgtccacacttcccaggagccctccacagtctgtaaaatctgt
gaattgtcctttgagacagatcaggttctcttacagcacatgaaagacaatcataagcct
ggtgaaatgccctatgtatgccaggtttgcaattacagatcatcagtctttgcagatgtg
gatgcacatttcagagcataccatggtaacactaagaatttactttgccccttttgtctc
aaaatttttaaaactgcaacaccatacatgtgtcattatagagggcactgggaaaagagt
tttcaccagtgttccaaatgtcggctacagtttttaactttcaaagagaaaatggagcac
aagacccagtgtcatcaaatgtttaagaagcctaagcagctagaaggattacctcctgaa
acaaaagttgttattcaggtatcactggaacctcttcaaccaggattggtggaagtagca
tccattactgtgaacatatctgattctgaaccatcaccccccaaatctaaaagtaggagt
tcaaaaaaaccctgttaa

DBGET integrated database retrieval system