KEGG   Bos taurus (cow): 517697Help
Entry
517697            CDS       T01008                                 

Gene name
ZNF280B, SUHW2
Definition
zinc finger protein 280B
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
17
AA seq 545 aa AA seqDB search
MEPPCMLCEENQEPEPQKSVGETKQVDDEDAELIFVGVEHVNEDADLIFVGMTSNSKPVV
SNILNRVTPGSCSRRKRYGHFRKDNAHKLQPVSHVTRTSEAKIVLPVSDSESRSTDSPII
IEPLSKPDYKNISPQIVPNSFSELCSPLITFTSSLQHPVETTVSAGDMNKSPRVSKRLST
SETNSTNPKRPKLSDGIIGEHSLALSPSGIFQQNFLTTQQSKPDSVHTSLSHVQNGEPCP
TAFAKDNVHCKPVSPLGENGLTKTDFPSLASQKKIVDPTEGNLIVLLRDFYYGQHIGDGQ
PEPKTHTAFKCLSCLKVLKNLKFMNHMKHHLELERQRGDSWKNHTTCQHCHRQFPTPFQL
QCHIESVHTSQEPSTVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCNYRSSVFADV
DAHFRAYHGNTKNLLCPFCLKIFKTATPYMCHYRGHWEKSFHQCSKCRLQFLTFKEKMEH
KTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNISDSEPSPPKSKSRS
SKKPC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaccatgtatgttatgtgaagaaaaccaagagccagaaccacagaaaagcgta
ggagaaaccaaacaagtagatgatgaagatgctgaactgatctttgttggagtggaacat
gtaaatgaagatgctgatctgatctttgttggaatgacctcaaattcaaaaccagtcgtt
tcaaacatattgaacagagttaccccaggttcatgttcaaggagaaaaaggtatggtcac
ttcaggaaagataatgctcacaaattacagcctgttagtcatgtgactcgtacatccgaa
gcaaagattgtcttgccagtttctgactctgaatcaagatcaacagatagtcctattatt
attgagcctttgtctaaacctgattataaaaatatttcaccacaaatagtgcctaatagc
ttttcagagttatgttctcctttgattaccttcacaagttcattgcagcatccagtagaa
acaacagtttctgcaggagatatgaataaaagtcctcgtgtatcaaagcgactttccact
tctgaaacaaatagcacaaatcccaaaaggcctaaactcagtgatggaattataggggaa
cattctttagctttgtccccttcaggtatttttcagcaaaattttttgactactcagcaa
agcaaaccagacagtgttcatacctcattaagccatgttcagaatggagaaccttgtcca
acagcttttgcaaaggacaatgttcattgcaagcctgtaagtcctttaggggaaaatgga
ctgacaaaaactgactttccaagtttagcaagtcaaaaaaagattgttgatcccacagaa
ggcaatctgatagtgttacttcgtgacttctactatggacagcatataggagatgggcag
ccagaaccgaagactcacacagcctttaaatgcctcagctgcttgaaagttctaaaaaat
ctcaagtttatgaatcacatgaagcaccatttggaacttgagaggcagagaggtgacagc
tggaaaaaccacaccacctgccagcactgccaccgccagtttcccaccccattccagctg
cagtgtcacattgaaagtgtccacacttcccaggagccctccacagtctgtaaaatctgt
gaattgtcctttgagacagatcaggttctcttacagcacatgaaagacaatcataagcct
ggtgaaatgccctatgtatgccaggtttgcaattacagatcatcagtctttgcagatgtg
gatgcacatttcagagcataccatggtaacactaagaatttactttgccccttttgtctc
aaaatttttaaaactgcaacaccatacatgtgtcattatagagggcactgggaaaagagt
tttcaccagtgttccaaatgtcggctacagtttttaactttcaaagagaaaatggagcac
aagacccagtgtcatcaaatgtttaagaagcctaagcagctagaaggattacctcctgaa
acaaaagttgttattcaggtatcactggaacctcttcaaccaggattggtggaagtagca
tccattactgtgaacatatctgattctgaaccatcaccccccaaatctaaaagtaggagt
tcaaaaaaaccctgttaa

DBGET integrated database retrieval system