KEGG   Bos taurus (cow): 518393Help
Entry
518393            CDS       T01008                                 

Gene name
AOX4
Definition
aldehyde oxidase 1-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    518393 (AOX4)
   00350 Tyrosine metabolism
    518393 (AOX4)
   00380 Tryptophan metabolism
    518393 (AOX4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    518393 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    518393 (AOX4)
   00830 Retinol metabolism
    518393 (AOX4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    518393 (AOX4)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     518393 (AOX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 1335 aa AA seqDB search
MPSLSNSDELIFFVNGRKVIEKNADPEVYLLFYLRKILHLTGTKYSCGSGGCGACTVMVS
RYDPKTKKIHHYPVTACLVPICSLHGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITEALGGNLCRCTGYRPIVESGKTFCAESTVCQMKGSG
KCCMDQEEKSFTSRQEKMCTKLYNEDEFQPFDPTQEPIFPPELIRMAEDPNKRRLTFRGK
RTTWITPVNLNDLLELKTSFPEAPIIMGNTAVGPSIKFRDEFHPVFISPLGLQELYFVDS
TDDGVTIGAGYSLAQLNDALRFIVSEQPKEKTKTYHALLKHLRTLAGAQIRNMATLGGHV
VSRPNYSDLNPILAAGNATINLISKEGKRQIPLDGRFLEKSPEANLKSEETVLSVYIPHS
TQWHFVSGLRIAQRQENAFAIVNAGMSVKFEDGTDTIKELQMFYGSVGPTVVSASKTCQQ
LIGRKWNDQMLSDACRLVLDEIYIPPDAEGGMVEYRRTLIISLLFKFYLKVRRGLNKMDP
HKFPDIPEKFVSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVF
VDDMPPISQELFLAVVTSTRAHAKIILIDTSAALALPGVVDVITAEDVPGDNSYQGEIFY
AQNEVICVGQIVCTVAADTYAHAKEAAKKVRIVYEDLEPRIITIEQALEHNSFLSAEKKI
EQGDVEQAFKYVDQIIEGKVHVEGQEHFYMETQTILAIPQEEDKEMVLHLGTQFQTHVQE
YVAAALSIPRNRIACHTKRAGGAFGGKVSKPALLGAVSAVAAKKTGRPIRFILERGDDML
ITAGRHPLLGKYKIGFMNNGVIKAADIEYYINGGCSPDESELVMEFMVLRSENAYYIPNF
RCRGRPCKTNLPSNTAFRGFGFPQGIVVGEAYITAVASQCDLTPEQVKEINMYKRTSRTA
HKQTFNPEPLRRCWKECLEKSSFSARKLAAEEFNKKNYWKKRGLAAVPMKFTVGMPTAFY
NQAAALVHIYLDGSVLVSHSGCELGQGLHTKMIQVASRELNIPESYIHLSETNTTTVSNA
TFTAGSMGTDINGKAVQNACQILKARLEPVIRKNPRGTWEAWISEAYKESISLSTTGYFK
GYQTNMDWKKGEGNAFPYFVYGASCSEVEVDCLTGAHKLLRTDIFMDAAFSINPAVDIGQ
IEGAFVQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVTEIPEEFNVTLVHSQNPIAIYS
SKGLGEAGMFLGSSVLFAIYDAVAAARRERGLTKTFTLSSPATPELIRMTCVDQFTDMIP
RDDPSTFTPWSIHVS
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgccttctctttccaattctgatgagttgattttttttgtgaatggaagaaaggtcata
gagaagaatgctgatcctgaagtatatctactattctacttgaggaaaatcctccacctc
accggcaccaaatacagctgtgggagcggaggctgcggtgcctgcactgtcatggtgtcc
agatacgacccaaagaccaagaagatccaccattatccagttacagcgtgcctggtgccc
atctgctctctgcatggggctgctgtcaccactgtggaaggtgtaggaagcatcaaaact
aggattcaccccgtgcaggaaagacttgccaagtgtcatgggacacagtgtggcttctgc
agcccaggaatggtgatgtccatctacacgctgctgaggaaccacccggagcccacccct
gagcagataaccgaagctcttggaggtaatttgtgccgctgtactggataccgaccaatt
gtagaaagtggaaaaactttctgtgcggaatcaactgtttgtcaaatgaaaggatcagga
aaatgttgcatggatcaagaagagaagtctttcacaagtagacaggaaaaaatgtgtacc
aagctgtacaacgaagatgaattccagcccttcgatccaacccaggaacctatattccct
cctgaactgataagaatggcagaagacccgaacaaaaggaggctgacgttccgagggaag
aggaccacctggatcactcctgtaaacttgaatgaccttctggagctgaaaaccagtttc
cctgaagcccccatcatcatggggaacactgcagtgggacccagcattaaattcagagat
gaattccatccggtttttatatctccacttgggcttcaagaactatatttcgtggatagc
acagatgatggggtgacgataggcgcaggatacagcctggcccagttgaatgatgcctta
cgttttattgtttctgaacaaccaaaggagaagaccaagacctaccacgctctcctgaag
cacctgagaacacttgctggagcccagattaggaacatggcgactttaggcgggcatgtg
gtgagcaggcctaactattctgacctgaatcccatcttagcagcaggaaatgctaccatc
aatctgatatctaaagaaggaaaacggcagattcctttagatggccgtttccttgagaag
tcacctgaagccaacctcaagtcagaagagactgtgttatctgtgtatattccgcactct
actcagtggcactttgtgtcaggactccggatagcccagcgtcaggagaacgcctttgcc
attgtcaatgctgggatgagcgtgaagtttgaggatggcacagacaccatcaaggaactt
cagatgttctacggaagtgttggccccactgttgtgtctgcaagcaaaacctgccagcag
ctcattgggaggaaatggaacgaccagatgctgagtgatgcttgccgattggttctggat
gagatttacatccctccagacgctgaaggtggcatggtagagtataggcgaaccctcatc
atcagcttactcttcaaattctacctcaaagtgaggcgagggctgaacaaaatggacccc
cacaagtttcctgatattccagaaaagttcgtgagtgcgctagaagatttccctatagaa
acaccccaaggcattcagatgttccagtgcgtggatccccaccaacccccacaagatcca
gttggccacccagtcatgcaccagtcagccattaaacacaccacaggggaagctgtgttt
gttgatgacatgccccccatctcccaagaactcttcctggctgtagtcaccagcaccaga
gctcatgcaaagataatattaattgatacttcagcagccctggcccttcctggtgttgtt
gatgtgataacagcagaggatgttccaggagataatagctatcagggagagattttctac
gcacaaaatgaggtaatttgcgtgggtcagatcgtctgcactgtggctgctgatacctat
gctcatgcaaaagaagctgctaaaaaagtgaggattgtttatgaagacctagagcccagg
attataacaatagagcaagccctagagcacaattcatttctttctgctgagaaaaaaatt
gagcaaggagatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtaaggtc
catgtggaaggacaggaacatttttacatggaaacacaaactatcctggctatcccccaa
gaggaagataaagaaatggtgctacaccttgggacacagtttcagacccatgtgcaggaa
tatgtggctgcagcactaagcatcccaaggaacagaatcgcctgtcacacgaaaagagct
ggaggagcattcggggggaaagtgagcaagcctgctctgctaggagctgtcagtgccgtg
gctgccaaaaagactggccgcccaatacggttcattctggaacgtggtgatgacatgttg
ataactgctggccgccacccactgctcggaaaatacaaaattggattcatgaacaatggt
gtgatcaaagctgctgatattgaatattatatcaatggcggatgcagtcctgatgagtct
gagttggtgatggagttcatggtgctgagaagtgaaaatgcatattatattcctaatttc
cggtgtcggggtagaccttgcaaaacaaatttgccatccaacactgctttccgaggattt
ggcttcccccagggcatagtggtcggtgaagcttatataactgctgtggcttctcagtgt
gacttaacccctgaacaggttaaagaaataaacatgtataagagaactagcagaacagcc
cataagcagacatttaatcctgagcccttgagaagatgctggaaagaatgtctggagaaa
tcttccttctctgctaggaaactggctgccgaggaatttaacaaaaagaactactggaag
aagagggggcttgctgcggtccccatgaaatttacagttgggatgcccacagccttctac
aatcaggctgctgctcttgtccacatctatctcgatggctccgtcttggtgagtcacagt
ggctgtgaactaggacaaggtcttcacaccaaaatgatccaggtggcgagtcgtgaactg
aacatccctgagtcgtatatacacctgtctgagacgaacactaccacggtttccaatgcg
accttcacagctggctcaatggggacagacatcaacgggaaggctgtgcagaatgcctgc
caaattcttaaggcccgtcttgagccagtcatcaggaaaaaccccaggggaacgtgggag
gcgtggatttcagaagcctacaaagaatccatcagtctctccactactggatatttcaaa
ggctaccagacaaatatggactggaagaagggggaaggtaacgctttcccatattttgtt
tatggagcatcctgttccgaggttgaagtcgactgtctcacaggggctcataagctcctt
aggactgacatcttcatggatgctgctttcagcataaacccagctgtggacattggacag
attgaaggagcatttgtccaaggcatgggattctataccatagaagagctgaaatactct
ccagaaggcgtgctttactctcgaggtccagatgactacaaaatccccaccgtcactgaa
atacctgaagagttcaatgtcactttggtgcattcccaaaatcccatcgccatctactcg
tccaaggggttaggtgaggctggaatgttcctgggatcctccgtgttgttcgccatatat
gatgccgtggctgctgcccgcagagagagggggctgaccaagactttcaccctgagtagc
ccagcaacccctgaattgattagaatgacttgtgtggatcagttcactgacatgattccc
agagatgatccatcaacatttacaccttggtccatccatgtgtcttaa

DBGET integrated database retrieval system