KEGG   Bos taurus (cow): 518752Help
Entry
518752            CDS       T01008                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    518752 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    518752 (ARG2)
   00330 Arginine and proline metabolism
    518752 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    518752 (ARG2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     518752 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 354 aa AA seqDB search
MSLRSHLSRLLRTQVHSVRKKSVHSVAVIGAPFSQGQKRKGVEYGPAAVRXAGLMKRLSD
LGCHLKDFGDLNFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLGVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGIYITEEIHSTGLLSALDLVEVNPR
LAVSEEEAKATASLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESESEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaggagccacctctcgcgtctcctccggacgcaagtgcactccgtccggaag
aagtctgtccactccgtggctgtcattggagccccattctcccagggacagaaaagaaaa
ggagtggaatatggtcctgctgctgtaaganaagctggcttgatgaaaaggctctcggat
ctgggctgccaccttaaagacttcggagatttgaattttactccagttcccaaagatgat
ctctataacaacttgatagtgaatcctcgctcagtgggcctggccaaccaggaactagcg
gaggtggttagccgagctgtgtcaggtggctacagctgtgtcacggtgggaggagaccac
agcctggcaatcggtaccatcagtggccacgcccgacactgcccagaccttggtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctacat
ggacagccagtttcgtttctcctcagagaactacaggacaaggtaccacagctcccagga
ttttcctggatcaaaccttgtatctcttctccaagtattgtatatattggactaagagac
gtggaccctcctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacattcgatctgctgattggc
aaaagacaaaggccaatccatctgagtttcgatattgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtagggggactgacctatcgagaaggcatatatattact
gaggaaatacacagtacagggttgctctcggccctggacctcgttgaagtcaatcctcgg
ttggccgtgtcagaggaggaggccaaggctacagccagcctggcagtggacgtcattgct
tcgagtttcgggcagacgagggagggagggcatattgtctacgaccaacttccaactccc
agctcaccagatgaatcagagagtgaagaacgtgtaagaatttag

DBGET integrated database retrieval system