KEGG   Bos taurus (cow): 518768Help
Entry
518768            CDS       T01008                                 

Gene name
POM121C, POM121
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    518768 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 1216 aa AA seqDB search
MSPAATAAGGGNRRRPIASVREGRGWGCGRPAGAALLGLSLLGLVLYLVPAAAALAWLAV
GATAAWWGLSREPRGSRALSSLVWNARRQRTLLASPPAKSAANGNLLEPRSPLEGPDPAE
LLLMGSYLGKPGPPQPAPAPEARDLRERPGRRPPVRTASPAPSAHPQRVQVHPSLPTSLL
RPSRRPSYRDCGTLSHRFVVTPRRRYPIQQAQYSLLGVLPTVCWNGCHKKTVLSARNSRM
VCSPVTVRIAPPDSKLARSPVPEQMINSTLSSPSTSAPDPCAKETVLNALKERKKRTVGE
EDQMSADGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQNSDDHLNK
RSRTSSVSSLTSSTCTGGIPSSSRNAIASSYSSTRGLSQLWKRSGPSSSPFSSPASSRSQ
TPERPAKKVREEELSHHSSSSTPLVTDKESQGEKIADPTTGKKQNSWNSPSTPGSSGQRK
RKVQLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKVLEDKTDAASTSVTEA
PPAGQSSFTLTLPAAGTASSPTTLQAPSANPLLESLKKMQNSPGLPSLPEPAGVTSTVAD
SPPKTPSPLASLSSSQSGALPATSSDSRSTTTVLGLTPASSPGPVTDAAKSPPAPSAETS
TKSQALSTPPPSPKQSILFGMLSTPAANPPASVAPAASSASPMFRPIFVAPLKSESGDPL
PSSPSTVTAVTSSSSALPTTASSTAPAFKPIFSSVGPPTSVPGLTPFLKQTATLATTTSA
PLFTGQATATSTVTSVTTASTSTDSAPKPSFSFGVSSVTSTLSSVTSTTASASQPFLFGT
PPTSGASFTPAGGSIFQFGKPPAMPASTSVTTFGQSLPSAPQTAPSSSSSSSTGFGGFGS
SLSTSAPATTGQPTLTFSSTTTPAFNIPFASGAKPPLPSYPGANPQPTFGAAEGQPQGAA
KPALVPSFGSSFTFGNSAAPAPTATPAPTPAQPAFGGAAQPAFGSLKATPSAFGTSATTR
PAFGSATAVFSFGAATTSGFGATTQTTSSGTSGSVFGGTTPSPFMFGGPATLAGSGAFGM
SVATPGTGAASGAFGFGAGQSGATGSTAPFGGGLSQNSLGTPSQTTSFAFSVTSTPDSKP
VFGGTSTPTFGQNTPAPGVGAAGSSLSFGASSTPAQGFVGVGPFGSTAPSFSIGAGSKTP
GARQRLQARRQHTRKK
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctacggcggctggaggaggcaaccgacggcggccgatagcgagtgtc
agggagggccgcggctggggctgtggccggccggccggggcggcgcttctcggcctgtcg
ctgctcggcctcgtgctgtacctggtgccggcggcggctgccctggcctggctggctgtg
ggggctactgcggcctggtggggactgagccgcgagccccgaggttcgcgcgcgctctcc
tcgctcgtttggaacgcgcggcgtcagcgaacactgctcgcctcgcctcctgccaaatcg
gcagcaaacggaaatctcttagagccgcggagcccgctcgaaggacccgaccccgctgaa
ctgctcctcatgggcagttacctgggcaagcccggccccccgcagcctgcccccgccccg
gaggccagggacctgcgggagaggccgggccgccgccctcctgtccgcaccgcgtcgccg
gctccgtcggcgcatccccagcgtgttcaagttcacccttcccttcccacttctcttctc
cgaccctccaggaggccttcctaccgggactgtgggactttatcacatcggtttgtagta
acacctcgaaggcgctatccaatccagcaggcccagtattccttgctgggggtgcttccc
acagtatgctggaatggttgtcacaagaagactgtgctgtctgctcgtaattccagaatg
gtgtgcagccccgtgacagtgaggattgcgcctccggatagcaagctggctcgttctcca
gtaccagaacagatgatcaactcaacactgtcttcaccgtcgaccagtgccccagatccg
tgtgcgaaggagactgtgctgaatgccctcaaagagagaaagaagaggacagtaggggag
gaagaccaaatgtctgctgatggccaggaaaataaaagaagacgccatgatagcagtggg
agcggacattcagcgtttgagccccttgtggccaatggcgtccctgcttcttttgtgcct
aagcctgggtctctgaagagaggtcttaattcacagaactcagatgatcacctgaataag
agatcccgcacctcttctgtgagctccttgacaagcagcacgtgcacaggcggcatcccc
agctccagccgcaacgccatcgccagttcctacagctccacgcgtggtctctctcagctg
tggaagaggagtggtcccagttcatctccattctctagcccagcctcatcccgctcccag
acaccagagaggccagcaaagaaagtaagagaagaggagctttctcatcattctagttct
tcaactccattggtaacagacaaggagtcccagggagaaaagattgcagatccaaccaca
gggaagaagcagaactcatggaattccccatcaacacctggcagctccgggcagcgtaaa
cggaaggttcagctgctgccctccaggcgaggagaccagctgaccttgcctccacctccc
cagcttggttattcgatcactgctgaggacttggacttggaaaagaaagcttcgttacaa
tggtttaacaaagtcttagaggataagactgacgctgcctcgacctctgttaccgaggcc
ccacctgccggtcagtcttccttcactttgaccctgcctgccgctgggactgcttcatcc
ccaaccaccctccaagcccctagcgctaacccacttttggagagcttgaagaagatgcag
aattccccggggctaccttccctccctgaacctgctggagtgaccagcactgtggccgat
tcgcccccgaagacacccagtcctctggcctctctgagctcctcacagtcaggagccctt
ccagccacctcctccgactccagatccaccactactgtcttggggctgaccccggcttct
tccccaggacccgtcaccgatgccgccaagtcccctccggccccttcggctgagacgtcc
accaaatcccaggccctgtccaccccgcctcccagccccaagcagagtatcctgtttgga
atgctgagcaccccagctgccaaccctcctgcttctgtagcccctgctgcgtcttcagca
tcgcccatgttcaggcccatttttgtggcccccctgaaaagcgagagtggggaccccttg
ccctctagcccttccacggtcacggctgtgacatcttccagctcggccctccccacgact
gccagcagcacagcccccgctttcaagccaatctttagcagtgtggggccacccacatct
gtgcccgggctaactcccttcttgaagcaaacagctactctggccactaccacgagtgcc
cctctcttcaccggccaggccactgccacctccacagtgacttccgtgaccacagccagc
acctccacagactctgctccgaagccctcgttcagcttcggtgtgagcagcgtgaccagc
accctcagcagcgtgaccagcaccactgcttccgcctcccagcccttcctctttgggact
cccccgacttctggtgccagcttcaccccagctgggggctccatattccaatttggcaag
cctcccgccatgcccgcctccacatcagtcaccacctttggccagtcacttcccagtgcc
cctcagacagcccccagcagcagcagcagcagcagcactggcttcggtggttttggcagc
agcctcagcacctccgctccagctaccaccggccagcccacgctgacgttcagcagcacc
accaccccagccttcaacattccctttgcctcgggtgccaagccccctctcccatcctac
ccaggcgccaacccccagcccaccttcggggccgctgaggggcagcctcagggggctgcc
aagccggctctcgtgcccagctttggcagctctttcacttttggtaactctgcggcccca
gccccgactgcgaccccagcgccgaccccagcccagccagcgttcggcggcgccgcgcag
ccggcgtttggcagtctgaaagccacaccctccgccttcggcacctccgccaccacccgg
ccggcctttggcagcgccacagctgttttctcctttggtgcggccaccacctctggcttt
ggcgctaccacccagactaccagcagcgggaccagcggctcggtgttcggcggcacgaca
ccatcgcccttcatgtttgggggaccagccaccctggctgggagcggggcctttgggatg
agtgtggccaccccgggcaccggcgctgcctctggagcgttcggcttcggggcaggacag
agtggggccactggcagcacagcaccttttgggggaggcttgagtcagaacagcttgggc
acgcccagccagaccacgtcctttgccttcagtgtgaccagcacgccggacagcaaacct
gtgtttggaggcacctccacgcccaccttcggtcagaacaccccagcccctggggtggga
gcagctggcagcagcctctcctttggggcgtcctcaacacctgcccaaggctttgtcgga
gtcggacctttcggatcgacagccccttccttttccatcggtgcgggatccaagacccca
ggggctcgacagcggctacaggcccggaggcagcacacccgcaagaaatag

DBGET integrated database retrieval system