KEGG   Bos taurus (cow): 518852Help
Entry
518852            CDS       T01008                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    518852 (EHHADH)
   01212 Fatty acid metabolism
    518852 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    518852 (EHHADH)
   00650 Butanoate metabolism
    518852 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    518852 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    518852 (EHHADH)
   00310 Lysine degradation
    518852 (EHHADH)
   00380 Tryptophan metabolism
    518852 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    518852 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    518852 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    518852 (EHHADH)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     518852 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     518852 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     518852 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 723 aa AA seqDB search
MAEFTRLQNCLALIRLRNPPVNAISTTVARGIKESLQKAITDDTVKAIVICGADGIFCAG
ADIREFKVHKTFDIQLGDIVDEIQRNKKPVVAAIQKLALGGGLELALGCHYRIAHAEAQV
GFPEVTLGILPGARGTQLLPRLVGVPAALDLIISGRHISANEALKLGIIDKIVNSDPIEE
SIKFAQRISDQSPESRRICNMPVPSLPNMDAIFSEALLQVRKRYPGWLSPEACVQAVQAA
VQYPYDMGSKKEKELGLYLNTSGQAKALQYVFFAERMANKWSTPSGASWKTALGRPISSV
GVLGLGTMGRGIVISFAKAQIPVIAVESDKKQLETASKIITSILEKEASKMQQSGHPWSG
PKPRLTTSMKELSGVDLVIEAVYEDMNLKKHVFAELSAVCKPEALLCTNTSALDIDEIAS
SSDRPHLVIGTHFFSPAHVMKLLEVIPSRFSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLRSYYDQTYFLLEEGSKPEEIDEVLEEFGFKMGPFRVSDLAGLDIGWKSRKGQGLT
GPTLPPGSSARKRGGRRYCPIPDMLCESGRFGQKTGKGWYLYDKPLGRIHKPDPWLSQFL
AQYRETYHIKPRIISRDEILERCLYSLINEAFRILGEGMAAIPEHIDVIYLHGFGWPRHR
GGPMFYASTVGLPTVLEKLQKYHRQNPDIPQLEPCDYLKKLASQGNLPLEEWQSLAGPPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttcacgcggctgcagaactgcctggcactgatccgtctacgaaacccgcca
gtcaatgcgatcagtacaactgttgcccgtggaataaaagagagtctgcagaaagctata
acagatgatacagttaaagccattgtgatttgtggagcagatggcatcttctgtgcaggt
gccgatattagagaattcaaagttcataagacctttgacatacaactgggagatatagta
gatgaaatacagagaaacaagaagcctgtggtggcagctatccaaaagttggctttagga
gggggactggagctggccctgggctgtcactatagaattgcccatgcagaggctcaagtt
ggcttcccagaagtcacactaggaatccttcctggtgcaagaggaacccagcttctcccc
agacttgttggagtgcctgctgcacttgacttgattatctcaggaagacatatttcagca
aatgaagcacttaagctgggtattatagataaaattgtgaactcagacccaattgaagaa
tcgatcaaatttgcccagagaatttcagatcaatctccagaatcccgtagaatctgcaac
atgccagtcccgagcttgcccaacatggatgccattttcagtgaagcccttctgcaggtg
cggaagcggtaccctgggtggctgtctccggaggcctgtgtccaagcagtccaggctgct
gtccaatatccatatgacatgggcagcaagaaggaaaaggagctgggcctgtaccttaat
acctcagggcaggccaaggccctgcaatatgttttctttgctgagaggatggcaaataag
tggtccactccctctggagcttcctggaaaacagcgttgggacggcccatctcctctgtt
ggcgttctcggcttaggaacaatgggccgaggcattgtcatttcttttgcaaaggcccag
atccctgtgattgccgtagaatcagacaagaagcagctagagactgcaagcaagataata
acctccatcttggaaaaagaagcatccaaaatgcagcagagtgggcacccttggtcagga
ccaaaacccaggttaactacatctatgaaagagctcagtggtgtagatttagtcattgaa
gcagtttatgaggacatgaacttgaagaagcatgtctttgctgaactatcagctgtgtgc
aagccagaagcacttttatgcaccaacacttcagccctggacattgatgagattgcttct
tccagtgaccgtcctcacttggtcattggcacccacttcttctcaccagctcatgtcatg
aagttgttagaggttattcccagccgattctcttcccccaccaccattgccacggttatg
aatttatcaaaaaagattaagaagattggagtagttgtaggcaattgttttggatttgtt
gggaatcgaatgctgaggtcttattatgatcagacatacttcttattagaagaaggcagt
aaaccagaggagatagatgaggtgctggaagagtttggtttcaaaatgggaccttttaga
gtgtctgatcttgctgggttggatataggttggaaatcccgcaaagggcaaggtcttact
ggacctacattgcctccaggaagttctgcccggaagcgaggcggccggagatattgccca
attcctgatatgctgtgtgagtcaggacggtttggtcagaagacaggtaagggttggtac
ctttatgataaacccctggggaggattcacaaacctgatccctggctttcccaatttctg
gcacagtacagggaaacgtatcacatcaaaccacgtatcattagccgggatgagatcctc
gagcgctgcctatattcactcatcaatgaggcatttcgcatcttgggagaagggatggcg
gctatcccagagcacattgatgttatctatttacacgggtttggatggccaaggcacagg
ggtgggcccatgttctatgcttccacagttgggttgcccacagtgctagagaagttgcag
aaataccacaggcagaatcctgatattccccaactagagccttgtgactatcttaaaaaa
ctggcttcccagggaaaccttcctctggaagagtggcaaagcttggcaggaccccccagc
agtaaactgtga

DBGET integrated database retrieval system