KEGG   Bos taurus (cow): 518852Help
Entry
518852            CDS       T01008                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
bta  Bos taurus (cow)
Pathway
bta00071  Fatty acid degradation
bta00280  Valine, leucine and isoleucine degradation
bta00310  Lysine degradation
bta00380  Tryptophan metabolism
bta00410  beta-Alanine metabolism
bta00640  Propanoate metabolism
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta01212  Fatty acid metabolism
bta03320  PPAR signaling pathway
bta04146  Peroxisome
Module
bta_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
bta_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
bta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    518852 (EHHADH)
   00650 Butanoate metabolism
    518852 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    518852 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    518852 (EHHADH)
   00310 Lysine degradation
    518852 (EHHADH)
   00380 Tryptophan metabolism
    518852 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    518852 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    518852 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    518852 (EHHADH)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     518852 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     518852 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     518852 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 TrkA_N UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 518852
NCBI-ProteinID: NP_001069248
Ensembl: ENSBTAG00000019625
UniProt: E1BMH4
Position
1
AA seq 723 aa AA seqDB search
MAEFTRLQNCLALIRLRNPPVNAISTTVARGIKESLQKAITDDTVKAIVICGADGIFCAG
ADIREFKVHKTFDIQLGDIVDEIQRNKKPVVAAIQKLALGGGLELALGCHYRIAHAEAQV
GFPEVTLGILPGARGTQLLPRLVGVPAALDLIISGRHISANEALKLGIIDKIVNSDPIEE
SIKFAQRISDQSPESRRICNMPVPSLPNMDAIFSEALLQVRKRYPGWLSPEACVQAVQAA
VQYPYDMGSKKEKELGLYLNTSGQAKALQYVFFAERMANKWSTPSGASWKTALGRPISSV
GVLGLGTMGRGIVISFAKAQIPVIAVESDKKQLETASKIITSILEKEASKMQQSGHPWSG
PKPRLTTSMKELSGVDLVIEAVYEDMNLKKHVFAELSAVCKPEALLCTNTSALDIDEIAS
SSDRPHLVIGTHFFSPAHVMKLLEVIPSRFSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLRSYYDQTYFLLEEGSKPEEIDEVLEEFGFKMGPFRVSDLAGLDIGWKSRKGQGLT
GPTLPPGSSARKRGGRRYCPIPDMLCESGRFGQKTGKGWYLYDKPLGRIHKPDPWLSQFL
AQYRETYHIKPRIISRDEILERCLYSLINEAFRILGEGMAAIPEHIDVIYLHGFGWPRHR
GGPMFYASTVGLPTVLEKLQKYHRQNPDIPQLEPCDYLKKLASQGNLPLEEWQSLAGPPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttcacgcggctgcagaactgcctggcactgatccgtctacgaaacccgcca
gtcaatgcgatcagtacaactgttgcccgtggaataaaagagagtctgcagaaagctata
acagatgatacagttaaagccattgtgatttgtggagcagatggcatcttctgtgcaggt
gccgatattagagaattcaaagttcataagacctttgacatacaactgggagatatagta
gatgaaatacagagaaacaagaagcctgtggtggcagctatccaaaagttggctttagga
gggggactggagctggccctgggctgtcactatagaattgcccatgcagaggctcaagtt
ggcttcccagaagtcacactaggaatccttcctggtgcaagaggaacccagcttctcccc
agacttgttggagtgcctgctgcacttgacttgattatctcaggaagacatatttcagca
aatgaagcacttaagctgggtattatagataaaattgtgaactcagacccaattgaagaa
tcgatcaaatttgcccagagaatttcagatcaatctccagaatcccgtagaatctgcaac
atgccagtcccgagcttgcccaacatggatgccattttcagtgaagcccttctgcaggtg
cggaagcggtaccctgggtggctgtctccggaggcctgtgtccaagcagtccaggctgct
gtccaatatccatatgacatgggcagcaagaaggaaaaggagctgggcctgtaccttaat
acctcagggcaggccaaggccctgcaatatgttttctttgctgagaggatggcaaataag
tggtccactccctctggagcttcctggaaaacagcgttgggacggcccatctcctctgtt
ggcgttctcggcttaggaacaatgggccgaggcattgtcatttcttttgcaaaggcccag
atccctgtgattgccgtagaatcagacaagaagcagctagagactgcaagcaagataata
acctccatcttggaaaaagaagcatccaaaatgcagcagagtgggcacccttggtcagga
ccaaaacccaggttaactacatctatgaaagagctcagtggtgtagatttagtcattgaa
gcagtttatgaggacatgaacttgaagaagcatgtctttgctgaactatcagctgtgtgc
aagccagaagcacttttatgcaccaacacttcagccctggacattgatgagattgcttct
tccagtgaccgtcctcacttggtcattggcacccacttcttctcaccagctcatgtcatg
aagttgttagaggttattcccagccgattctcttcccccaccaccattgccacggttatg
aatttatcaaaaaagattaagaagattggagtagttgtaggcaattgttttggatttgtt
gggaatcgaatgctgaggtcttattatgatcagacatacttcttattagaagaaggcagt
aaaccagaggagatagatgaggtgctggaagagtttggtttcaaaatgggaccttttaga
gtgtctgatcttgctgggttggatataggttggaaatcccgcaaagggcaaggtcttact
ggacctacattgcctccaggaagttctgcccggaagcgaggcggccggagatattgccca
attcctgatatgctgtgtgagtcaggacggtttggtcagaagacaggtaagggttggtac
ctttatgataaacccctggggaggattcacaaacctgatccctggctttcccaatttctg
gcacagtacagggaaacgtatcacatcaaaccacgtatcattagccgggatgagatcctc
gagcgctgcctatattcactcatcaatgaggcatttcgcatcttgggagaagggatggcg
gctatcccagagcacattgatgttatctatttacacgggtttggatggccaaggcacagg
ggtgggcccatgttctatgcttccacagttgggttgcccacagtgctagagaagttgcag
aaataccacaggcagaatcctgatattccccaactagagccttgtgactatcttaaaaaa
ctggcttcccagggaaaccttcctctggaagagtggcaaagcttggcaggaccccccagc
agtaaactgtga

DBGET integrated database retrieval system