KEGG   Bos taurus (cow): 518914Help
Entry
518914            CDS       T01008                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    518914 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    518914 (LAMC3)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    518914 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    518914 (LAMC3)
   05222 Small cell lung cancer
    518914 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    518914 (LAMC3)
   05145 Toxoplasmosis
    518914 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
11
AA seq 1428 aa AA seqDB search
MGTAAALLLSLALLAPRAAGARMGACYDGAGRPQRCLPVFENAAFGRLAEASHTCGRPPE
DFCPHVGAQGAGAPCQRCDAADPARHHNASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVN
ITLNLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCQKTYGRPEGLFL
RPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLVSLD
RLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDEEGRLACRCQHNTTGT
DCERCLPFFQDRPWARGTAEAANECLPCNCSGHSEECTFDRELFRSSGHGGRCLHCRAHT
AGPHCERCQENFYRWSPQTPCQPCDCHPAGSLRLQCDDLGTCVCKPTVMGWKCDRCLSGF
HSLSEGGCRPCTCNPVGSLGTCDPRSGRCHCKENVEGSLCDRCRPGAFNLQPHNPAGCSS
CFCYGHSKVCVAAAQFQEHHILSDFRQGAEGWRAGSVGDPGHPARWSPGGLLLDPEDEEA
ELTAPEKFLGDQRFSYGQPLTLTFQVPRGSSLSTQLRLEGAGLALTLRHSGSPRTPVSGQ
AGEVRLKFLLQETSEDVDPPLSAFHFQRVLANLTALRIRTSGHSTSSSGPVLLTEVRLTS
ARRGLSPPASWVETCSCPQGYTGQFCESCAPGYKRNTPLGGPYASCVPCTCNQHGTCDPN
TGVCLCGHHTEGPSCERCLPGFYGNPFTGQADDCQPCPCPGQSACTTIPESGEVVCTHCP
RSQRAIPPLILFPRSLRLRAAQEGPGFLTTAALDRKAEETQLASVTGLALDAWTSRWVLA
AARGLSLVAESGTYSLIAERGLLVAVASLAAEQGSKAAKLKARLTLMEGWLQGSDCGRPW
GPLDILQGEAPRGDIYQGPHLLQGAQEAFLEQVTGLEGAVKAAREQLQALGRSARCAQAG
VEKTCIQLADLEAALESSEEEILHAATILASLVIPQEGLGQPTNWSKLATEAHALARSHR
DTAAKIEATARRALLASNTSYALLWSLVEGRAALEAQQELEDRYQEVQAAQKALGTAVAE
ALPEAERVLAAVQQAGVAAALHLASPSAPASPPQKSQAEAVSLKVQTLEKTVTSREHMVT
EAAGSLQATAQAVLQEMEPLTQLHQEARAALTRASSSVQAATVTVMGARTLLADVEGMKP
RFPRPKDQAALRRKAAIVQDRILADSRKKTKQAERMLGDAASVSSRAKKKGREAELLAQD
SAKLAKALLRAGKQEHRRASGLSSQTRATLGLASRQLLASEAHRQELEAAEWDGAGLSQM
ERQIRESRTSLEKDIKALLDLLARLGSLDTHRAPARALNETQWALERLRLRLSPPGALQG
KLSLLEQESKLQELQIQSFENDLSELRADKQNLEAILHSLPESCASWQ
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atgggcacggcggcggcgctcctgctgagcctggcgctcctggcgccgcgcgcggccgga
gcgcgcatgggcgcgtgttacgacggcgcggggcgcccgcagcgctgcctgccggtgttc
gagaacgcggcgttcggccggctcgccgaggcctcgcacacgtgcggccgcccgcccgag
gacttctgcccgcacgtgggtgcccagggcgcgggggcgccgtgccagcgctgcgatgcc
gccgaccccgcacgccatcacaacgcctcctacctcaccgacttccacagccaggacgac
agcacgtggtggcagagcccgtccatggccttcggagtgcagtaccccacctcggtcaac
atcaccctcaaccttgggaaagcttacgagatcacctacgtacggctgaagttccacacg
agtcgacctgagagctttgccatctacaagcgcagccgggcagggggcccctgggagccc
taccagtactacagcgcctcgtgccaaaagacctacggccggcccgagggcctgttcctg
cggccgggcgaggacgagcgtgtggccttctgcacctccgagttcagcgacatctccccg
ctgagcgggggcaacgtggccttctccaccctggagggccggcccagtgcctacaacttt
gaagagagccctgtgttgcaggagtgggtcaccagcacagagctcctcgtctccctggac
cggctcaacacgtttggggatgacatcttcaaggaccccaaggtgctacagtcctactac
tacgccgtgtcggatttctcggtgggcggcaggtgcaagtgcaatgggcacgccagcgag
tgtggcccagacgaggagggccggctggcctgtcgatgccagcacaacaccacgggcacg
gactgcgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcacggccgag
gccgccaacgagtgtctaccttgcaactgcagcggccactctgaggagtgcacctttgac
cgggagctcttccgcagctcaggccacggtggccgctgcctgcactgccgtgcccacaca
gctgggccgcactgcgagcgctgccaggagaacttctatcgctggagcccgcagacgccc
tgccagccctgcgactgccacccagcaggctccctgcgcctccagtgcgatgacttgggc
acctgcgtctgcaagcccacggtgatgggctggaagtgtgaccgctgcctgtctgggttc
cactcgctcagcgagggcggctgcagaccctgtacctgcaatcctgtgggcagcctgggc
acctgtgatccccgcagtgggcgctgccactgcaaagagaacgtggaaggcagcctgtgt
gacagatgtcgtccgggtgcgtttaacctgcagccccacaaccccgccggctgcagcagc
tgcttctgctacggccactccaaggtgtgtgtggccgctgcccagttccaggagcaccac
atcctctctgacttccgccagggagccgagggctggcgggccggaagcgtgggggaccca
ggacatcctgcacgatggagcccgggggggctcctcctggacccagaggacgaggaggcg
gagctcacagcaccagagaagtttctgggagatcagcgattcagctacgggcagcccctc
acactgaccttccaggtcccccgtggctcctcactctccacgcagctgaggctggaaggg
gcgggcctggccctgactctgcggcattccggctcaccccgcaccccggtctccgggcag
gcgggggaggtacggctgaagttcctgctgcaggagacctccgaggacgtggaccctcca
ctgtccgccttccacttccagcgggtgctcgccaacctgactgctctgcgcatccggacc
agcggccacagcaccagctcttccggtcccgtgcttctgactgaggtccggctcacatcc
gcccggcgggggctgtccccaccagcctcctgggtggagacttgttcgtgtccccaggga
tacaccggccagttctgtgagtcctgcgctccaggatacaagaggaacacgcccctgggg
ggtccctatgccagctgtgttccctgcacctgtaaccagcatggtacctgtgaccccaac
acaggggtctgcctgtgtggccaccacaccgagggcccgtcctgtgagcgctgcttgcca
ggtttctacggcaaccccttcacaggccaggccgacgactgccagccctgcccgtgcccc
ggacaatcggcctgcacgaccatcccagagagcggagaagtggtgtgtacccactgcccg
cggagccagagagccatccccccactgatcctctttcctagaagcctccgtctccgggca
gcccaggaaggacccggcttccttaccacggcagcccttgacagaaaagccgaagaaacc
cagctggcatcggtcacaggtctggccctcgacgcctggacgtcgcgctgggtcctcgcg
gctgcccgcgggctctctctagttgcggagagtgggacctactctcttatcgcagagcga
gggcttctcgtggctgtggcttctctggctgcagagcagggctctaaggctgccaagctg
aaggccaggctgaccctgatggaaggatggctgcaagggtctgactgtggcaggccctgg
ggaccgctggacattctacagggagaggccccacggggggacatctatcagggcccccac
ctgctgcaaggggcccaggaagccttcttggagcaggtgacaggacttgagggtgctgtg
aaggctgcccgggagcagctgcaggcgctgggcaggagtgcccgctgtgcccaggctgga
gtggagaagacctgcatccagctggcggacctagaggcagcactggagtcctcggaagag
gagattctgcatgcggccaccatcctcgcatctctggtgattcctcaggaagggctcggc
caacccaccaactggagcaagctggccacagaggcacatgcccttgccaggagccacagg
gacaccgctgccaagattgaggccacggctcggagggccctgctcgcctccaacaccagc
tatgcacttctctggagcctggtggagggccgagcggccctggaggcccagcaggagctg
gaggacaggtaccaggaggtacaagcggcccagaaggcgctgggcacggctgtggcagag
gcgctgcccgaagctgagagggtgctggccgctgtgcagcaagccggcgtggccgcggcc
ctgcacctggcctcaccttccgccccagcatcaccgcctcagaagtcccaggccgaggcc
gtgagcctgaaggtgcagacgctggagaagacagtcacatcgagagagcacatggtgacc
gaggctgccgggtccctgcaggccaccgcccaggccgtgctgcaggagatggagccccta
acgcagctgcaccaggaagccagagccgccctgacccgagcttcctcatctgtccaggct
gccacggtgactgtcatgggagccaggactctgctggctgacgtggaaggaatgaagcca
aggtttcctcggcccaaggaccaggccgcgctgaggaggaaggcggctatcgtccaggac
aggatccttgcagactcgagaaagaagaccaagcaggcagagaggatgctgggagatgcg
gcttctgtctcctccagggccaagaagaagggcagggaagccgagctgctggcccaggac
agtgccaagctcgccaaggccttgctgagggcagggaagcaggaacaccgccgggctagc
gggctctccagccagacgagggcgaccctcggactggcctcccggcagctgctggcctca
gaagcacacagacaggagctggaggcggctgagtgggatggtgccgggctgagccagatg
gaacggcagatccgggagtcacgcacctctctggagaaggacatcaaagccttgttggac
ctgctcgccaggctggggtcgctagacacccacagagccccagccagggccctgaacgag
acccagtgggcactggagcgtctgaggctgcggctgagtcccccgggggccctgcagggg
aaactgagcctcttggagcaggagtccaagctgcaggagctgcagatccagagcttcgag
aacgacctctcagagctccgcgccgacaagcagaacttggaggccatcctgcacagcctg
cccgagagctgtgccagctggcagtga

DBGET integrated database retrieval system