KEGG   Bos taurus (cow): 519018Help
Entry
519018            CDS       T01008                                 

Gene name
SKP2
Definition
S-phase kinase-associated protein 2 (p45)
Orthology
K03875  
F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Cell cycle
Ubiquitin mediated proteolysis
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Module
SCF-SKP2 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:bta04120]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bta04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:bta04110]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:bta05222]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
20
AA seq 424 aa AA seqDB search
MHRKHLQEIPDQSSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPQELLSNLG
HPQSPPRKRLKSKGNDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SSVCKRWYHLAFDESLWQTVDLAGRNLYPDVVGRLLSRGVVAFRCPRSFMDQPLVEHFSP
FRLQHLDLSNSVIDASTLHGLLSHCSKLQNLSLEGLRLSDPVVDNLAQNTNLLRLNLSGC
SGFSESALKTLLSSCSRLDELNLSWCYDFTEKHVQMAVAHVSKTITQLNLSGYRKNLQRS
DVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLSLEK
PSCL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaaacacctccaggagatacccgaccagagtagcaacgttaccaccagtttc
acgtggggatgggattctagcaagacttctgaactgctttcaggcatgggggtctccgcc
ctggagaaggaggaggtggatagtgagaacatcccccaggaactgctttcaaacctgggc
cacccacagagccccccacgaaaacggctgaaaagcaaagggaatgacaaggactttgtg
attgtccgcagacctaagctaaaccgagagaactttccaggtgtttcttgggactccctt
ccagacgagctgctcttaggaatcttttcctgtctgtgcctccctgaactcctgaaagtc
tccagtgtttgtaagagatggtatcatctagcatttgacgagtctctctggcagactgta
gacctcgcgggcagaaacctctacccagatgtggttggtcggcttttgtcccgaggggtg
gttgccttccgctgtccacgatcatttatggaccaaccgttagttgaacatttcagccct
ttccgactacagcacctggacctgtcgaactctgtgatcgatgcgtctaccctgcacggc
cttctatctcactgctccaagttgcagaatctcagcctggaaggcctccgactttcagat
cccgttgttgataatcttgctcagaacacaaatttactgcgactaaacctttctgggtgt
tctggattctctgaatctgccctgaagactttgctgagcagctgttccagactggatgaa
ctgaacctctcctggtgctatgatttcactgaaaagcatgtacagatggccgttgcacat
gtgtcaaagaccatcacccagctgaatctcagcgggtaccgaaagaatctgcagagatca
gatgtctctaccttagttggaagatgtcccaatcttgtccacctagacttaagcgatagt
gtcatgctgaaaaatgactgctttccagaattttaccaactcaactacctccaacacctg
tcactcagtcggtgctatgacataatacctgaaactttacttgaacttggagaaattccc
acattaaaaacactacaagtctttggaatcgtaccagacggtacccttcaattgttaaag
gaagccctccctcatctacagattaattgctcccatttcaccaccatcgccaggccgacc
attggcaacaagaagaaccaagagatatggggcatcaaatgccgactgtcactggagaag
cccagttgcctatga

DBGET integrated database retrieval system