KEGG   Bos taurus (cow): 519018Help
Entry
519018            CDS       T01008                                 

Gene name
SKP2
Definition
S-phase kinase-associated protein 2 (p45)
Orthology
K03875  
F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Cell cycle
Ubiquitin mediated proteolysis
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Module
SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    519018 (SKP2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    519018 (SKP2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    519018 (SKP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    519018 (SKP2)
   05203 Viral carcinogenesis
    519018 (SKP2)
   05222 Small cell lung cancer
    519018 (SKP2)
  Infectious diseases
   05168 Herpes simplex infection
    519018 (SKP2)
   05169 Epstein-Barr virus infection
    519018 (SKP2)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     519018 (SKP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
20
AA seq 424 aa AA seqDB search
MHRKHLQEIPDQSSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPQELLSNLG
HPQSPPRKRLKSKGNDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SSVCKRWYHLAFDESLWQTVDLAGRNLYPDVVGRLLSRGVVAFRCPRSFMDQPLVEHFSP
FRLQHLDLSNSVIDASTLHGLLSHCSKLQNLSLEGLRLSDPVVDNLAQNTNLLRLNLSGC
SGFSESALKTLLSSCSRLDELNLSWCYDFTEKHVQMAVAHVSKTITQLNLSGYRKNLQRS
DVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLSLEK
PSCL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaaacacctccaggagatacccgaccagagtagcaacgttaccaccagtttc
acgtggggatgggattctagcaagacttctgaactgctttcaggcatgggggtctccgcc
ctggagaaggaggaggtggatagtgagaacatcccccaggaactgctttcaaacctgggc
cacccacagagccccccacgaaaacggctgaaaagcaaagggaatgacaaggactttgtg
attgtccgcagacctaagctaaaccgagagaactttccaggtgtttcttgggactccctt
ccagacgagctgctcttaggaatcttttcctgtctgtgcctccctgaactcctgaaagtc
tccagtgtttgtaagagatggtatcatctagcatttgacgagtctctctggcagactgta
gacctcgcgggcagaaacctctacccagatgtggttggtcggcttttgtcccgaggggtg
gttgccttccgctgtccacgatcatttatggaccaaccgttagttgaacatttcagccct
ttccgactacagcacctggacctgtcgaactctgtgatcgatgcgtctaccctgcacggc
cttctatctcactgctccaagttgcagaatctcagcctggaaggcctccgactttcagat
cccgttgttgataatcttgctcagaacacaaatttactgcgactaaacctttctgggtgt
tctggattctctgaatctgccctgaagactttgctgagcagctgttccagactggatgaa
ctgaacctctcctggtgctatgatttcactgaaaagcatgtacagatggccgttgcacat
gtgtcaaagaccatcacccagctgaatctcagcgggtaccgaaagaatctgcagagatca
gatgtctctaccttagttggaagatgtcccaatcttgtccacctagacttaagcgatagt
gtcatgctgaaaaatgactgctttccagaattttaccaactcaactacctccaacacctg
tcactcagtcggtgctatgacataatacctgaaactttacttgaacttggagaaattccc
acattaaaaacactacaagtctttggaatcgtaccagacggtacccttcaattgttaaag
gaagccctccctcatctacagattaattgctcccatttcaccaccatcgccaggccgacc
attggcaacaagaagaaccaagagatatggggcatcaaatgccgactgtcactggagaag
cccagttgcctatga

DBGET integrated database retrieval system