KEGG   Bos taurus (cow): 519280Help
Entry
519280            CDS       T01008                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    519280 (GPX6)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    519280 (GPX6)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    519280 (GPX6)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     519280 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 519280
NCBI-ProteinID: NP_001156614
Position
1
AA seq 221 aa AA seqDB search
MILQLWASCLFPLFLVGLAQLTPKQQQMKVDCYKGVTGTIYEYGALTLNGEEYIQFKQYV
GKHVLFVNVATYUGLTAQYPELNALQEELKPFGVVVLGFPCNQFGKQEPAKNSEILMGLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNACPPTSDLLGSSSQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMRWYHRASVSTVKSDMLEYLKQFKSE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcagctctgggcctcatgtcttttcccactgttcctggtcggcttagctcag
ctgactccgaagcagcaacagatgaaggtggattgctataagggggtgacaggcaccatc
tatgagtatggagccctcaccctcaatggtgaggagtatatccagttcaagcagtatgtg
ggcaagcatgtcctgtttgtcaatgtggccacctattgaggcttgacagctcagtatcca
gaactgaatgcactacaggaggagctgaagcctttcggtgtagttgtgctgggctttccc
tgcaatcaatttggaaaacaagagccagcaaagaactcagagatccttatggggctcaag
tatgtacgtccaggtggtggctttgttcccaattttcagctctttgagaaaggggatgtg
aatggagaaaaagaacagaaggtctttaccttcctgaagaacgcctgccctccaacctct
gatcttttgggctcatcaagtcagctcttctgggagcccatgaaggtccatgacattcgc
tggaactttgagaagtttctagtggggcctgatggcgtccctgtcatgcgttggtaccac
cgggcttcagtcagcacagttaaatcagacatgctggagtacctgaagcagttcaaaagc
gaatag

DBGET integrated database retrieval system