KEGG   Bos taurus (cow): 519920Help
Entry
519920            CDS       T01008                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  
translation initiation factor 4E
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    519920 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    519920 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    519920 (EIF4E2)
   04150 mTOR signaling pathway
    519920 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    519920 (EIF4E2)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     519920 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     519920 (EIF4E2)
Translation factors [BR:bta03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    519920 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagagtcagagc
agcagtaagaggaaggctgtcgtccctgggccggccgagcacccactgcagtataactac
actttttggtactccaggagaacccccggccgtcccaccagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtgcgtcccggggacttgacaggccacagcgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggcggaaagtggataattcgactgcgg
aagggcttggcatcccgctgctgggagaatctcatcttggctatgctgggggaacagttc
atggttggggaggagatctgcggggctgtggtctctgtccgctttcaggaggacattatt
tccatatggaataagactgccagcgatcaagccaccacggcccgcatacgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaacccacaccgacagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagcggccgctga

DBGET integrated database retrieval system