KEGG   Bos taurus (cow): 519934Help
Entry
519934            CDS       T01008                                 

Gene name
H2B
Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    519934 (H2B)
  Immune diseases
   05322 Systemic lupus erythematosus
    519934 (H2B)
  Substance dependence
   05034 Alcoholism
    519934 (H2B)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   519934 (H2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
23
AA seq 126 aa AA seqDB search
MPEPAKKVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKPSTITPREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggctaaaaaagttcctgcccctaaaaagggctctaaaaaagctgtgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaagtccatccggacaccggcatctcgtccaaggccatg
ggaatcatgaactcattcgtcaatgacattttcgagcgcatcgctggcgaggcatcgcgc
ctggcgcattacaacaagccctcgactatcacacccagggagatccagaccgccgtgcgc
ttgctgctacctggggagctagccaagcatgccgtgtccgagggcactaaggctgtcacc
aagtataccagctccaagtaa

DBGET integrated database retrieval system