KEGG   Bos taurus (cow): 519935Help
Entry
519935            CDS       T01008                                 

Gene name
HIST1H2BD, HIST1H2BI
Definition
(RefSeq) histone cluster 1, H2bd
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    519935 (HIST1H2BD)
  Immune diseases
   05322 Systemic lupus erythematosus
    519935 (HIST1H2BD)
  Substance dependence
   05034 Alcoholism
    519935 (HIST1H2BD)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    519935 (HIST1H2BD)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   519935 (HIST1H2BD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 519935
NCBI-ProteinID: NP_001039711
Ensembl: ENSBTAG00000031778
UniProt: Q2KII5
Position
23
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccaccaagtcagctccagccccaaagaaaggctcgaagaaggcggtgacc
aaggcgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg
ggcatcatgaattcatttgtcaacgacatcttcgagcgcatcgcgggggaggcgtcgcgt
ctggcgcattacaacaagcgctcgaccatcacatctagggagatccagacggccgtgcgc
ctgctgttgcccggggagttggccaaacacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system