KEGG   Bos taurus (cow): 519935Help
Entry
519935            CDS       T01008                                 

Gene name
HIST1H2BD, HIST1H2BI
Definition
histone cluster 1, H2bd
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:bta05322]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccaccaagtcagctccagccccaaagaaaggctcgaagaaggcggtgacc
aaggcgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg
ggcatcatgaattcatttgtcaacgacatcttcgagcgcatcgcgggggaggcgtcgcgt
ctggcgcattacaacaagcgctcgaccatcacatctagggagatccagacggccgtgcgc
ctgctgttgcccggggagttggccaaacacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system