KEGG   Bos taurus (cow): 519992Help
Entry
519992            CDS       T01008                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     519992 (USP16)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   519992 (USP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 826 aa AA seqDB search
MGKKRTKGKTVPIDDSSESLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEETEENPSVWLCLKCGHQGCGRNSQEQHALKHYMKPRSEPHCLVLSLDNWSVWCYLCD
DEVHYCNSNRLGQVVDYVRKQAGNTTPESAEDNGNIELENKKLEKESKNEQEREKKENMA
RENPSMNSTSQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPRELFSQVCKKAVRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFDNSTEKVDEELKNKVKEYEKKKSVPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNLKKTMEDEDKDSEEEKDN
DSYLKERNDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDVYAIDHPEDNEC
EVEMSLQREADIKSNHISQEEVAPKEYCVNQKDLNGHEKMIESITDNQKSTEEAAMKNVS
VDNDLEVLASSATECPRNLNGAYLKEGSNGEVDISSGFENLNLNAALQPDEINIEILDDD
PTPGTKVYEVVNEDPETAFCTLANREAFNTDECSVQHCLYQFTRNEKLRDANKLLCEVCT
RRQYSGPKANMKGERKHIYTNAKKQMLISLAPPVLTLHFKRFQQAGFNLRKVNKHIKFPE
ILDLAPFCTLKCKNVAEEHTRVLYSLYGVVEHSGTMRSGHYTAYAKTRTANTHLSNLVLH
GDIPQDFEMESTKGQWFHISDTHVQAVPTTKVLSSQAYLLFYERIL
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaattgatgattcttctgaatcttta
gaacctgtgtgcagacacattagaaaaggattggaacaaggtaatttgaaaaaagcttta
gtgaatgtggaatggaatatttgccaagattgtaagacggacaataaagtaaaagataaa
tctgaagaagaaacagaagaaaatccttcagtttggctgtgtcttaaatgtggccatcag
ggctgtggcagaaattctcaggagcaacatgctttgaagcactacatgaaaccaagatca
gaacctcattgcctggttcttagtttggacaactggagtgtatggtgttacctatgtgat
gatgaagtccattattgtaattcaaaccgattgggtcaggtggttgattatgttagaaag
caggctggcaatacaactccagaatcagcagaagataatggtaatattgaacttgaaaac
aaaaagctagaaaaggagagtaaaaatgagcaagagagagaaaaaaaggaaaacatggcg
agagaaaatccttccatgaattctacttcccaaataactgtgaaaggactcagtaatttg
ggaaatacatgtttcttcaatgcagttatgcagaatttgtcacaaacaccagtgcttaga
gaactattaaaagaagtaaaaatgtccggaacaattgtaaaaattgaaccacctgatttg
gcactaacagaacccttagaaataaatcttgagccaccaggccctcttacgttagccatg
agccagtttcttaacgagatgcaagagaccaaaaagggaatcgtgacacctagagaactc
ttttctcaggtctgtaaaaaagcagtgcgatttaaaggctaccagcaacaggacagtcag
gagctgcttcgctatttattggatggaatgagagcagaagaacatcagagagtgagtaaa
ggaattcttaaagcatttgataattctactgaaaaagtggatgaagaactgaaaaataaa
gttaaagagtacgaaaagaaaaaatcagtaccaagttttgtggaccgaatatttggtggt
gagctgacgagtacaatcatgtgtgatgaatgcagaactgtctccttggttcatgaatct
ttccttgatttgtctctaccggttttagatgatcagagtggtaagaaaagtataaatgat
aaaaatctgaaaaagacaatggaagatgaagataaagatagcgaggaagaaaaagataat
gatagttacttaaaggagagaaacgatattccttcaggaacaagtaagcacttgcagaaa
aaagcaaagaagcaagccaagaagcaagccaagaaccaacgaagacaacagaaaattcaa
gggaaagttcttcatttaaatgatgtttatgccattgaccatcctgaagataatgaatgt
gaagttgaaatgtcacttcagagagaagcagatattaaatccaaccatatctcacaagag
gaagttgcacctaaagaatattgtgttaatcagaaagatttgaacggccatgaaaaaatg
atagaaagtataactgacaatcaaaaatccacagaggaagcagctatgaaaaatgtcagt
gtggataatgatctggaggttttggcatcgtctgccactgaatgtcctaggaatttaaac
ggtgcctacctgaaggaagggagcaatggagaagtggacatttccagtggttttgagaac
cttaacttgaatgctgctctgcaacctgacgaaataaatatagagattctggatgacgat
cctactcccgggacgaaggtatatgaggttgtaaacgaagatccagagactgctttctgt
acgcttgcaaatagggaggctttcaacaccgatgagtgttcagtccaacattgtttgtat
cagttcactcgaaacgagaaacttcgggatgctaataaactgctttgtgaagtgtgcacg
cggagacaatacagtggaccaaaggcaaatatgaaaggcgaaaggaagcatatttacacc
aatgctaagaagcagatgctaatttctcttgctcctccagttctcactcttcatttcaag
agatttcagcaggctggttttaaccttcgcaaagttaacaaacacataaaatttccagaa
atcttagatttggctcctttttgtacccttaagtgtaagaatgttgctgaagaacataca
cgggtactgtattccttatatggagtcgtcgaacacagtggtaccatgaggtcagggcat
tatactgcctacgccaagacaagaactgcaaacactcatctctctaaccttgttctccat
ggtgatattccacaagattttgaaatggaatcaaccaaagggcagtggtttcacatcagc
gacactcacgtgcaagctgtgcctacaactaaagtactaagttcacaggcttacctccta
ttttatgagagaatactgtaa

DBGET integrated database retrieval system