KEGG   Bos taurus (cow): 520039Help
Entry
520039            CDS       T01008                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    520039 (RASGRF1)
   04010 MAPK signaling pathway
    520039 (RASGRF1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    520039 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
21
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPTLSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEVEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDVDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPARSLELLFASGQNNKLLYGDPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYTSMYSAMSPFGKAT
LDTSKLYVSSSFANKIPDEGDTATEKSEEPSALSKQSSEVSMREESDNDQNQSDDGDTET
SPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDSNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVISFLEEVMHDPELLTQERKAAANIIRTLTQDDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IVRNEDINARVSTIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctggggctgctggcgcgc
aaggacggaacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctctacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
cctacgctctcggccaaggagccgctggagaaacagcactatttcacggttaacttcagc
cacgagaaccagaaagccttggagctgaggacagaggacgccaaggactgcgacgagtgg
gtggcggccatcgctcatgccagctaccggaccctggccacggagcacgaggcgctgatg
caaaaatacctgcacctgctgcagatcgtggagaccgagaagacggtggccaagcagctg
cggcagcagatcgaggacggggaggtggagatcgagcgactgaaggcagagatcgcatct
ctgctcaaggacaatgagcgcatccagtccacccagactgtcacccccaacgacgaagac
agtgacatcaaaaaaatcaagaaggtgcagagcttcctgcggggctggctatgccggcgc
aagtggaagaccatcatccaggactacatccggtcaccgcacgcagacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggccgaggccgagtacgtgcagcagctgcac
atcctggtgaacaacttcctgcgcccactgcggatggccgccagctccaagaagcccccc
atcacgcacgacgacgtcagcagcatcttcctgaacagcgagaccatcatgtttttgcac
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggcc
gacctgttcgacatcctgctgcccatgctcaacatctaccaggagttcgtgcgcaaccac
cagtacagcctgcagatcctggcgcactgcaagcagaaccgcgactttgacaagctgctc
aagcactacgaggccaagcccgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgacgctgcacgagctcctggcacacacacct
catgagcacgtggagcgcaacagcctggactatgccaagtccaaactggaggagctgtcc
aggataatgcacgatgaagtcagtgagaccgagaacatccggaaaaacctggccattgaa
cgcatgatcattgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
gggtccctcatccaggtgcccatgtccgagaagggcaagatcaccagggggcgcctgggg
tccctttccctgaagaaggagggcgagaggcagtgcttcctgttttctaagcacctgatc
atctgcaccagaggctctggtggaaagcttcacctgactaagaacggagtcatatccctc
attgactgcaccttgctggaggaaccggagagcacggaggaagaagccaaagggtccggc
caagatgtagaccacttggatttcaagatcggggtggagccaaaggattcaccacccttc
acggtcatcctcgtggcctcgtccagacaggagaaggcggcatggactagtgacatcagc
cagtgtgtggataacatccggtgcaacgggctgatgatgaacgcctttgaggagaactcc
aaggtcacagtgccacagatgatcaagtccgacgcttccttgtattgcgacgacgtggac
attcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccggtacgccagcgtg
gagcggctactggagcgactgaccgatctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcttaccgcgtcttcaccactgctgttgtggtcctagacaagctcatcacc
atctacaggaagcccatcagtgccatccccgccaggtcactggagctcttgtttgccagt
ggccagaacaacaagctcctgtacggggacccacccaagtccccacgtgccacccgcaag
ttctcctcgccgccacccctgtccatcaccaagacgtcatcacccagccgccggcggaag
ctctccctgaacatccccatcatcacaggcggcaaggccctggacctggccgcgctcagc
tgcagctccaacggctacaccagcatgtactcggccatgtcgccctttggcaaagccaca
ctggacaccagcaagctctacgtgtccagcagctttgccaacaagatcccagacgagggt
gacactgccaccgagaaatccgaagagccctctgccctcagcaagcagagctcagaagtc
tccatgagggaagagtcagacaatgatcaaaaccagagtgacgatggtgacactgagaca
tcccccaccaaatctccaacgacaccaaaatcggtcaaaagcaaaaactcctcagagttc
cccctcttctcctacaataatggagtggtcatgacctcctgtcgcgagctggatagtaac
cgcagcgccctatcagcagcctctgccttcgcgatagcaactgcgggtgccaacgaggga
accccaaacaaggagaagtaccggaggatgtccttggccagtgcaggctttccccccgac
cagaggaacggagacaaggaatttgtgattcgcagagcagccaccaaccgcgtcctgaac
gtgctccgacactgggtgtccaagcattctcaggactttgagaccaatgacgagctcaaa
tgcaaggtcatcagcttcctggaggaggtcatgcatgacccagagctcctgacccaggag
cggaaggctgcggccaacatcatcaggactctgacccaggatgacccaggcgacaaccag
atcacactcgaggagatcacacagatggctgaaggcgtgaaggccgagccctttgaaaac
cactcagccctggagattgcggagcaactgaccctactggatcacctcgtcttcaagaag
atcccttatgaggagttcttcggacaagggtggatgaaactggaaaagaatgagaggacc
ccttatatcatgaaaaccactaagcatttcaatgatatcagtaacttgatcgcttcagaa
atcgtccgcaacgaggacatcaacgcgagggtgagcaccatcgagaagtgggtggctgtg
gccgacatatgccgatgcttacacaactacaatgctgttttggagatcacctcgtccatg
aaccggagcgcgatcttccggctgaaaaagacgtggctcaaagtctctaagcagactaaa
gctttgattgacaagctccaaaagcttgtgtcatcagagggcagatttaagaatctgaga
gaagctctgaaaaattgcgacccgccctgtgtcccttacctggggatgtacctcactgac
ctggccttcatcgaagagggtacgcccaactacacggaggacggcctggtcaacttctcc
aagatgagaatgatatcccacatcatccgagagatccgccagtttcaacaaactgcctac
aagatcgagcaccaagcaaaggtaacccagtatttactggaccaatcttttgtaatggat
gaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system