KEGG   Bos taurus (cow): 520120Help
Entry
520120            CDS       T01008                                 

Gene name
HIST3H2BB
Definition
histone cluster 3, H2bb
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    520120 (HIST3H2BB)
  Immune diseases
   05322 Systemic lupus erythematosus
    520120 (HIST3H2BB)
  Substance dependence
   05034 Alcoholism
    520120 (HIST3H2BB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   520120 (HIST3H2BB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 126 aa AA seqDB search
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccgtccaaatcagctcccgcacccaagaagggctccaaaaaagctgttact
aaagcgcagaagaaggatggcaaaaagcgtaagcgcagccgcaaagagagttattccatc
tacgtgtataaggtgttgaagcaagtgcacccggacaccggtatctcttccaaggctatg
ggcatcatgaactcgttcgtgaacgacatcttcgaacgtatcgctagcgaggcctcgcgt
ttggcgcactacaacaagcgttctaccatcacgtcccgggaggtgcagacggctgtgcgc
ctgctattgcccggcgagttggccaaacacgctgtctcggaaggtaccaaagccgtcacc
aaatataccagctctaaatga

DBGET integrated database retrieval system