KEGG   Bos taurus (cow): 520167Help
Entry
520167            CDS       T01008                                 

Gene name
LAMB2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    520167 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    520167 (LAMB2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    520167 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    520167 (LAMB2)
   05222 Small cell lung cancer
    520167 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    520167 (LAMB2)
   05145 Toxoplasmosis
    520167 (LAMB2)
Cell adhesion molecules and their ligands [BR:bta04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      520167 (LAMB2)
   VLA-6
      520167 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 1802 aa AA seqDB search
MEWVAAGGRGRDLPGQPGPWQLHLGLLLSVLVTALAQAPAPDVPSCSRGSCYPATGDLLV
GRADRLTASSTCGLRGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFA
PQRRAAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYR
YFSYDCAADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRI
QNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAP
GAPAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDRHSHACKKCECHGHAHSC
HFDMAIYLASGNVSGGVCDGCQHNTAGRQCELCRPFFYRDPTKDLRDPAVCRSCDCDPMG
SQDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSANNPLGCQRCQCDPRG
TVPGGTPCDRNSGACFCKRLVTGQGCNRCLPGHWGLSHDLLGCRPCDCDIGGALDPQCNE
ATGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEEPRGQVLDVVERLVTPGGTPSWTG
PGFVRLQEGQVLEFVVASVPRAMDYDVLLRLEPQVPEQWAEMELTVQRPGPVSARSPCGH
VLPQDDHIPGTLRPGSRHMVFPRPVCLEPGISYKLHLKLVRTGGSAQPEAPYSGASLLID
SLVLLPRVLVLEMFSGGDAASLERRATFERYRCHEEGLMPSKPLPSEACAPLLISLSTLL
YNGALPCQCDPQGSLSSECNPHGGQCRCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPE
GALSGLCDATSGQCPCRAGAFGLRCDRCQRGQWGFPSCRPCVCHGHADECDPNTGTCLGC
RDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQVVCHC
QAGYTGLRCEACAPGHFGDPSRPGGGCQPCECSGNIDPTDPDACDPHSGQCLHCLYHTEG
PRCAHCKPGFHGQAARQSCHRCTCNLLGTDARQCPSTDHCNCDPSSGQCPCLPNVQGLSC
DRCAPNFWNLTSGRGCQPCACHPSRARGPACNEFTGQCHCRAGFGGRTCSECQELHWGDP
GLQCRACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPTCHPCHACFGD
WDRVVQDLAARTRRLEQWTQELQQTGVLGAFESSFRHLQEKLGTVQGIVAARNASAASTA
QLVEATKELRREIGEATEHLTRLEAELTDVQDDNFNANHALSSLERDGLALNLTLRQLDQ
HLDLLKHSNFLGAYDTIRQAHSLSAEAERRANMSALIVPSPVSNSADTRHRTESLMSARR
EDFNRRHIANQRALGELSARTHALSLTGINELVCGSPGDAPCATSPCGGAGCRDEEGQPR
CGGLSCSGAAAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALD
KAHASRGQVEQANQELRQLIQNVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQQLA
GEIAERVRSLADVDTILARTVGDVRRAEQLLNDARRARSRAEGEKQKAETVQAALEEAQR
AQGAAQGAIQGAVVDTQDTEQTLHQVQERMAGAEQALSSAGERAQQLDGLLEALKLKRAG
NNLAASSAEETAGSAQDRAREAEQLLQGPLGDQYQTVRALAERKAQDVLAAQARAEQLRD
EARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNT
CQ
NT seq 5409 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggtcgcagcagggggacgagggagggacctgccgggacagcctgggccctgg
cagcttcatctgggcctgctgctgagcgtgctggtcaccgccctggcccaggccccagcc
ccggatgtgccaagctgttctcggggaagctgctaccctgccacaggcgacctgctggtg
ggccgcgctgacagactgaccgcctcgtccacctgtggtttgcgcggcccccagccctac
tgcatcgtcagtcacctgcaggatgagaagaaatgctttctgtgtgactcccggcgcccc
ttctctgccagagacaacccaaacagccatcgcatccagaatgtagttaccagctttgca
ccacagcgccgggcagcctggtggcagtcagagaatggtgtccccatggtcaccatccag
ctggacttggaggctgagttccatttcacacacctcatcatgaccttcaagacatttcgc
cccgctgccatgctggtggagcgctcggctgactttggacgcacgtggcgcgtgtaccgc
tatttctcctatgactgtgcggcagacttccctggagtcccgctagccccaccacggcat
tgggacgatgttgtctgtgagtcccgctactcagagattgagccatccactgaaggcgag
gtcatctatcgggtgctggaccctgccatccccattccagacccctacagcccacggatc
cagaacctgctgaagatcaccaacttgcgggtaaacctgacacggctacacacacttggg
gacaacctgcttgacccccggcgggagatccgcgagaagtactattatgccctctatgag
ctggtcgtgcgtggcaactgcttctgctacggacacgcctcacagtgtgcgcctgcccca
ggggcaccagcccacgctgagggcatggttcatggggcctgcgtctgcaaacacaacact
cgcggccttaactgtgagcagtgtcaggatttctatcacgacttgccctggcacccggct
gaggaccgccatagtcatgcctgcaagaagtgcgagtgccacgggcacgcccacagctgt
cacttcgacatggccatatacctggcatccggcaatgtgagtggaggcgtgtgtgatggg
tgtcagcacaacacagccgggcgccaatgtgagctctgccggcccttcttctaccgggac
ccgaccaaggacctgcgtgaccccgctgtgtgccgctcctgtgactgtgaccccatgggt
tcccaagacgggggccgctgtgatccccacgatgaccctgccctggggctggtctcgggc
cagtgtcgctgcaaagaacacgtggtgggctctcgctgccagcagtgccgcgacggcttc
tttgggctcagtgccaacaaccccctgggctgccagcgatgtcagtgtgacccacggggc
acggtgccggggggcaccccttgtgaccgcaacagtggagcctgtttctgcaagcgtctg
gtgaccggccagggctgcaaccgctgcctgcctggccactgggggctgagccacgacctg
ctcggctgccgtccatgtgactgcgacatcggtggtgccttggatccccagtgcaacgag
gccacgggtcagtgccgctgccgccagcacatggtggggcgacgctgcgagcaggtgcag
cctggttatttccggcccttccttgaccacctaacttgggaggctgaggaaccccggggg
caggtgctcgatgtggtggagcgtctggtgacccctgggggcactccatcttggaccggc
ccgggctttgttaggctgcaggaaggccaggtgctggagttcgtggtggcctctgtaccg
agagccatggactacgacgtgctcctgcgcttggagccccaggtgccagagcagtgggca
gagatggaactgaccgtgcagcgtccagggcctgtgtctgcccgcagcccatgtgggcac
gtgctgccccaagacgaccacatcccagggaccctacggccaggcagcaggcacatggtg
tttcccagacctgtctgcctggagcctggcatctcctacaagctacatctcaagctggtg
cgaacaggaggaagtgcccagcctgaggccccctattctggagccagcctactcattgac
tcgctggtgctgctgccccgtgtcctggtgctggagatgtttagcgggggtgacgcagcc
tctctcgagcgccgggccacctttgaacgctaccgctgccacgaggagggtttgatgccc
agcaagccccttccttctgaggcctgtgcccccctcctcatcagcctgtccacgctgctc
tacaacggagccctgccctgtcagtgtgacccccagggctccctgagctccgagtgcaac
ccccatggcggtcagtgccggtgcaaacctgcagtggttgggcgccgctgtgacctctgt
gcccctggctactatggctttggccccacgggttgtcaagcctgccagtgcagccctgag
ggggcgctcagtggcctgtgtgatgccaccagtgggcagtgcccctgccgagctggtgcc
tttgggcttcgctgtgaccgctgccaacgaggccagtgggggttcccgagctgccggccc
tgcgtctgccatgggcacgcagacgagtgcgaccccaacactggcacttgcctgggctgc
cgggaccacactgggggtgagcactgtgaaaggtgcattgctggcttccatggggacccc
cggctgccctacgggggccagtgccggccctgcccctgccccgaaggccccgggagccgg
cggcactttgctacttcctgccacagggatgggtactcgcagcaggttgtgtgccactgc
caggcaggctacacagggctgcgatgcgaagcttgtgcccccgggcacttcggggaccca
tcaaggccaggcggcgggtgccaaccatgcgagtgcagtgggaacattgaccccacggac
ccggatgcctgtgacccccactcggggcaatgcctgcactgcttataccacacggagggg
ccgcgctgtgcccactgcaagcctggcttccatgggcaggctgcccgacagagctgtcac
cgctgtacctgcaacctgctgggcacagatgcccggcagtgtccatccactgaccactgc
aactgtgacccaagcagcgggcagtgcccatgcctccccaatgtccagggcctgagctgt
gaccgctgtgcccccaacttctggaacctcaccagtggccgtggctgccagccctgtgcc
tgccacccgagccgagccagaggccctgcctgcaacgagttcacaggtcagtgccactgc
cgtgctggtttcggcgggcggacctgttctgagtgccaggagctccactggggagaccct
gggttgcagtgccgagcctgtgactgtgaccctcgtgggatagatacacctcagtgtcat
cgttccacgggccactgcagctgccgccctggcgtgtctggcgtgcgctgtgaccagtgt
gcccgtggcttctcgggagtctttcccacctgccatccctgccacgcgtgctttggggac
tgggaccgcgtggtgcaggatctggcggcccgcacacggcgcctggagcagtggacgcaa
gagctgcagcagacgggcgtgctgggtgcctttgagagcagtttccggcacctgcaggag
aagctgggcactgtgcagggcatcgtggctgcccgaaacgcctccgccgcctccactgca
cagctcgtggaggccacaaaggagctgcggcgcgaaatcggggaggccacggagcacctg
acccggctggaggctgagcttacagacgtgcaggatgacaatttcaacgccaaccacgca
ctgagtagtctagagcgagacgggcttgcacttaatctcacgctgcggcagcttgaccag
catctggacctgctcaagcattcaaacttcctgggtgcctatgacaccatccgccaggcc
cacagcctgtctgcagaggcagaacgccgtgccaacatgtcggccctgatagtgcccagc
cctgtgagcaactcagcagacacccggcaccggacagagtccctgatgagtgcccggagg
gaggatttcaaccgcaggcacatagccaaccagcgggccctgggcgagctctctgcccgt
acccacgccctgagtctgacaggcatcaacgaactggtgtgtgggtccccaggagatgcg
ccctgtgctacgagcccctgcgggggtgccggctgccgggatgaggaggggcagccccgc
tgtgggggcctcagctgcagtggggcagcagccatggcggacctggcgctgggtcgggcc
cgccacacacaggcagagctgcagcgggcgttggcagaaggcggtggcatcctcagccag
gtagctgaaacccgtcgacaggcaggcgaggcccagcagcgggcccaggcagccctggac
aaggctcatgcgtccaggggccaggtggagcaggccaaccaggaactgcggcaacttatc
cagaatgtgaaagacttcctcagccaggagggggctgaccctgatagcattgagatggtg
gccacccgggtgctagaactctccatcccagcgtcgcctgagcagatccagcagctggcg
ggtgagattgcagagagggtccggagcctggcagatgtggacacaatcctggcgcgcact
gtgggagacgtgcgccgggccgagcagctcctgaacgacgcgcggcgggcacggagccgg
gctgagggtgagaaacagaaggcagagacagtccaggcagcactggaggaggcccagcgg
gcacagggtgctgctcagggtgccatccagggggcagtggttgacacacaggacacagag
cagaccctacaccaggtgcaggagaggatggcaggtgctgagcaggcactgagctccgca
ggtgagcgggctcagcaactggatggtctcctggaggctctgaaactgaagcgagcaggg
aataacctggcagcctcgagtgccgaagaaacggctggcagtgcccaggatcgtgcccgg
gaagctgaacagctgctgcagggccccctgggggaccagtaccagacagtgagggccctg
gctgagcgcaaggcccaggatgtgctggctgcgcaggcgcgggcagagcaactgcgggac
gaggctcggggcttgttgcaagccgctcaagacaagctgcagcggctgcaagagctggaa
ggcacttatgaggagaacgagcgggcgctggagggcaaagcggctcagctggacgggctg
gaggccaggatgcgcagtgtgcttcaggccatcaacttgcaggtccagatctacaacacc
tgccagtga

DBGET integrated database retrieval system