KEGG   Bos taurus (cow): 520170Help
Entry
520170            CDS       T01008                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     520170 (UCHL3)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   520170 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
12
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESASMSPEERARYLENYDAIRVTHETSAHEGQTEAPNIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcatcctaactggcagtttgttgatgtatatggaatggatcctgaa
ctccttagcatggttccaagaccagtgtgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaagaagaggaaaagataaaatctcagggacaagatgtt
acgtcgtcagtatatttcatgaagcaaacaatcagcaatgcctgtgggacgattggacta
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggagtctgcatcaatgagccctgaagaacgagccagatacctggagaac
tatgacgccattcgagttactcatgaaaccagtgcccatgaaggtcagactgaggcacca
aatatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccacggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaactg
agattcaatgccattgctctttctgcagcatag

DBGET integrated database retrieval system