KEGG   Bos taurus (cow): 520924Help
Entry
520924            CDS       T01008                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    520924 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 2012 aa AA seqDB search
MATLLAVNSAASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFISLFRNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKDDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDSSFIEESTEERDDMIHQLPL
LTERQYIATIHSRLQDSQPWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRNRADEDARM
IHMSMQMGNDPPISLRRDLEHLMLLIGELYKKNPFNLELALEYWCPSEPLQTSTILGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISILVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDSEDT
EEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPLAVKESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGMEDENRSVSGFLHFDTSTKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMDEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVLGPGEVHCAFSLDSSFTSPPP
TENPLVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEVAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGVFGMRDPPVFIPTPGDRYRQIL
LPALRLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDISAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDKLRQFKCQDDNVEG
DRVSRKDEIELAVQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQ
VPVVPYWHLPGLGIIVYLLRQSANDFFSYYDSHRRSVNKLQNVEQLPPDEIKELCQSVMP
AGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCTPTDS
QDSLFASRSLFKSRRLQDSFASESNLDFRSGLTTVSQHDIDQLLADAISAFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggcgactctgttggcggtaaattcggccgctagtctgtggggcccttacaaagacatt
tggcagactgtgggaaatgctctttggagaagacaacctgaggcggtccacctccttgac
atgattttgaagaagcacaaacctgacttcatctcattgttcagaaatcctccaaaaaac
gttcaacaacatgagaaggttcagaaagccagcacagagggagttgccattcagggtcaa
cagggaacccgacttcttcccgaacagctcattaaagaggcttttatcctcagtgacctt
tttgatattggagaactggcagctgttgaacttcttttggctggagagcaccaacagcca
cattttcctggcctcaccagaggattagtagctgttcttttatactgggatggaaagcgg
tgcattgcaaattccctgaaagccttgatacagtcccgacgaggaaagacatggaccctt
gaactcagtccagagctcgtttctatgacaacacggtttactgatgagctgatggagcaa
ggattgacttacaaagttcttactctggtgtcacagattgatgttaacaatgagtttgag
aaactgcagcgtgagagaggtctgggtagtgaaaaacatcggaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggcagaaagccttttcgcctgggcttgccagtcacct
ttaggcaaagatgacactctcctccttatcggacatttggaaagagtgacggttgaggcc
aacggctcgttggatgcagtgaacctggctcttcttatggcgcttttgtactgcttcgat
agcagctttatagaagaaagcacagaggaacgtgatgatatgattcatcaacttccgctg
ttgacagagagacaatacatcgcaacaattcactctcgccttcaggactcacagccttgg
aagctgccagggctgcaagccacagtgaggcttgcctgggcgctggccttgagggggata
tctcagctgcctgatgtgacagctctggctgaattcacagaagcagatgaagcaatggca
gagcttgcaattgctgacaacgttttcctgttcctcactgaatctgtagtggtgtcagaa
aacttctatcaggaggaattttacattcgtagaatccacaatctaattacagatttcttg
gcacttatgccaatgaaggtgaagcagttgaggaatcgggcagatgaagatgctcgaatg
attcacatgagtatgcagatggggaacgatccccccatttcgcttagaagggatctggaa
cacttaatgctcttgattggtgagctgtataaaaagaatcctttcaatttggaacttgcc
ctggaatactggtgtccgtcagagcctcttcagacttccactatcctgggttcttatctt
ggagtggctcaccagcgaccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggtgacctgttgcctccaactatttatattccttacttgaagatgctgcagggattg
gctaatgggccccagtgtgcccactactgtttcagcctgctcaaagtcaatgggagcagt
catgttgaaaatattcagggagcaggtggcagtcctgtttcctgggaacatttctttcac
tccttgatgctttaccacgagcacctccggaaggatcttccaagtgccgatagtgtccag
taccgtcacctcccttcacgtggtatcacccagaaggagcaagatgggttgattgctttt
ctgcagctgacatctaccatcattacttggagtgaaaatgctcgtttggcactctgtgag
catcctcagtggacgcccgtggtggtgattctgggcctcctgcagtgcagtatccctcct
gtactaaaggccgaactactgaagacacttgcagcgtttggaaaatctcctgaaattgct
gcttctctctggcagtcgttagagtatactcagatactgcagaccgttcgggttccaagc
cagaggcaagctattggtattgaggtggaactaaatgaaatagaatcccggtgtgaagaa
taccctttaactcgcgccttttgccagctaattagtatcctggtggagagctcctttcct
tctaatctgggtgctggactgcggccccctggttttgacccttatttgcagttcctgcga
gattctgtgtttctccgattccgtacaagggcttaccggagagcagctgaaaagtgggaa
gttgctgaggttgttctggaggtgttttataaattgctcagagattatgaacctcaactt
gaagattttgtggatcagtttgtggaactacaaggagaagaaataatagcctataagccg
ccgggatttagtctgatgtatcaccttctgaatgagtcacccatgttggagcttgccctt
agtttactagaggaaggtgttaaacagcttgatacctatgctcctttccctggaaagaag
cacctggagaaagcagtgcagcattgccttgcacttctcaatcttactctgcagaaggaa
aacctcttcatggatctgctgagagagagtcagctggctctgatcgtctctcctttagaa
cagctattacagggaatcaatcccagaaccaagaaggcagataatgtggtgaacattgcc
agatacctgtatcatggcaatactaatccagaattggcttttgaaagtgccaagatcctc
tgctgtatctcttgcaattccaatattcaaataaaattggttggagatttcacacatgac
cagagtgtaagtcagaagctgatggctggttttgtagagtgtttggatagtgaagataca
gaagaatttgtacgtctagaagagggctcagaacttgaaaagaaattagctggaatccgt
catgaaacaagaatccacatcttgaatcttctcattacctctctggaacgcaatccaccc
aatctcgctctctacctgttgggctttgaattaaagaaacctgtcagtaccacaaacctg
caagacccaggagtgttaggttgccctcggacctgccttcacgcaatcttgaacatcttg
gagaagggaactgaagggagaacaggcccactggccgtgaaggaatcccctcaactcgct
gagctgtgttaccaggtgatttaccagttatgtgcatgctctgatacatctggtcctact
atgaggtacttgagaaccagccaggacttcttattttctcaattgcagcatttgccattt
tctaacaaagaatatgaaatatctatgctgaaccagatgtcatggctgatgaagactgcc
tcaatagaactaagggtgacttctttgaatcgccagcgctcacacacccagaggctcctg
cacctcctgctggatgacatgccagtgaagccctactcagatggggaaggaggcatggaa
gatgaaaatagatctgtctctgggttcctgcactttgacacttctacaaaagtacgtcgc
aaaattctcaatattctcgactccattgacttcagtcaggagatccctgagcctttgcag
ttggatttctttgatcgggcccagattgaacaagtcattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcacagagttcttgtggccgaagtg
aacgcccttcagggtatggcagccataggacagagacctctcctgatggatgaaattagc
accatactccagtacgttgtaggaagaaacaaattgttgcagtgtcttcatgcaaaacgg
catgctctggagtcatggaggcagctggtagaaattatcctgacagcctgtccccaggac
ctcattcaagcagaggatcgccaactgattattcgtgatcttttacaagatgtgcatgat
aagatcctggatgatgaagcagcgcaggaattaatgcctgtggtagcaggtgctgtgttc
accctgactgctcacctgagccaagccgttcgcacggagcagaagcaacccttagtcttg
gggcctggagaggtccattgtgctttcagtctcgatagctcgttcacctcacctccaccc
acagagaacccactggtggggtttgcttctattggagattcttcacttcacatcatattg
aagaaactgttagacttcattttgaagacaggcggtggattccagcgagtgcggacgcac
ctgtatggctccctgctttactacttgcagattgcccagaggccggatgagccagacacc
ttagaagtggccaagaaaaccatgtgggaaaggctgactgcccctgaagatgtgtttagt
aaattacagcgagaaaacatagccatcatcgagagctatggtgccgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcatgagattggaaggatgctggcgctggctctcctt
gatcgaattgtctccgtggataagcagcagcagtggctcctgtatctgtctaacagtggc
tatctgaaggtgcttgtggacagcttggtagaagatgaccgtactttgcagagcttactc
actccacagcctccccttttaaaagccctatatacttatgaatccaaaatggcatttctc
acaagagtggccaagattcagcagggtgctttagagctgctgaggtctggcgtgattgtg
aggctggcacagtgccaagtctatgacatgcgcccagaaatggacccacagggcgtgttt
ggcatgagagaccccccagtgttcatccctactccaggagaccgataccgccagattctc
cttccagcccttcgcttgtgccaggtcatccttacgtccagcatggctcagcacttgcag
gcagcagggcaggtgttgcagtttctcatctctcattcagataccatacaagcaattctg
cgctgtcaggacattagtgcagggtctttgcaggaattggctctgctgacgggaatcata
agtaaagcagcacttcctggtatactaagtgaacttgatgttgatgtaaatgaaggatca
ctaatggagctacagggacatattggaagattccagcgccagtgcttaggactactaagt
cgctttggtggctccgacaaactgcgtcagtttaaatgtcaagatgataatgtggaggga
gatagagtgagcaggaaagatgagatcgaactggctgtgcagcagatttgtgccaatgtc
atggaatattgccaatcactcatgttacagagttcccctaccttccagcatgctgtgtgt
ctgttcacccctagcctttcggaaaccgttaacagagatgggccccgccaagatacccaa
gtgccagtggttccatactggcacctgcctggtttgggcattatcgtttacctgctgaga
cagagcgctaatgatttcttcagctattacgacagtcatcgacggagtgtcaacaagcta
cagaacgtcgagcagcttcccccagatgagataaaagagttgtgtcagtcagtgatgcct
gctggtgttgataaaatctccactgcccagaaatatgttctagcaagacggcgtttggtg
aagctgatcaacaatcgagctaaactgctttccctttgttctttcatcatagagacctgc
ctgtttattctctggcgccatctggagtactacttgttacactgcacacccaccgattct
caggattccttatttgcctccaggtccttatttaaaagcagaaggctacaagattccttc
gcttcggaaagcaatctggattttagaagtgggctaactacagtgagccagcatgatata
gaccagcttctggctgacgctatcagcgcttttggagaatcactacagaagaaacttctg
gacattgaaggattgtattcaaaagtgcgatctcgctatagtttcatacaagctctcgtc
agacgcatccgaggcctgctgaggatatcacggaactga

DBGET integrated database retrieval system