KEGG   Bos taurus (cow): 521379Help
Entry
521379            CDS       T01008                                 

Gene name
PFN3
Definition
(RefSeq) profilin 3
  KO
K05759  profilin
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04810  Regulation of actin cytoskeleton
bta05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    521379 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    521379 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    521379 (PFN3)
Membrane trafficking [BR:bta04131]
 Others
  Actin-binding proteins
   Others
    521379 (PFN3)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     521379 (PFN3)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   521379 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 521379
NCBI-ProteinID: NP_001071413
Ensembl: ENSBTAG00000020353
UniProt: Q32PB1
Position
7
AA seq 137 aa AA seqDB search
MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL
QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI
LNKTMHELIHGLRSQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg
gccattgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg
gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcaccttcctg
caggccgggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcg
gagggtgacggagtgctggatgcacgcaccaagggtctggacgggcgcgccatctgcgtg
ggccacacgcctcgggcgcttctcgtgctcatgggccggcggggtgtgcatgggggcatt
ctcaacaagacgatgcacgagctgatccatgggctgcgctcacagggcacctag

DBGET integrated database retrieval system