KEGG   Bos taurus (cow): 521730Help
Entry
521730            CDS       T01008                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
bta  Bos taurus (cow)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    521730 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    521730 (EEF2K)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     521730 (EEF2K)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   521730 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 723 aa AA seqDB search
MAEEDLIFRLEGVDGRPASRAGDSDTDSDDDEEGYFICSITDDPGAHQNVNFKVNNCHSN
LAKSERYGSSGSPAGSFHFKEAWKHAIEKAKHMPDPWAEFHLEDVATECATRHRYNAVTG
EWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDVYF
EDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKERPGRPLFHLEHYIEGKYIKYNSN
SGFVRDDNVRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTERGTDFGDGNLGV
RGMALFFHSHACNRICKSMGLTPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSPRV
RTLSGSRPPLLLRLSENSGDDNMSDVTFDSLPSSPSSATPHSQKLEHLHWPVFSDLDNMA
PRDQDPLDNHRDSENGGDSGYPSEKRGDLDDPEPREHGHSNGNRRYESDEDSLGSSGRVC
VEKWNLFNSSRLHLPRPSAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEAGRFCEK
DEEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEESKTKGFDYLL
KAAEAGDRQCMILVARAFDTGQNLSPDRSQSWPEALHWYNTALETTDCDEGGEYDGMQDE
PRYMLLAREAEMLFTGGCGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWAQ
MEE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaagacctcatcttccgcctggaaggcgtggatggccgcccagcctcccgg
gctggtgattcagacacagacagcgacgatgatgaggagggttacttcatctgctccatc
accgatgaccccggggcacaccagaatgtcaacttcaaggttaataactgccacagcaac
ctagcaaaaagcgagcgctacggctccagcgggtccccggctggctccttccatttcaag
gaagcttggaagcatgcaatcgagaaagccaagcacatgcctgacccctgggctgagttc
cacctggaagacgttgccacggaatgtgccacacgccacaggtacaacgctgttaccggc
gagtgggtggaggatgaagtcctaatcaaaatggcatcccagcccttcggccggggagca
atgagggagtgcttcagaacgaagaagctctccaacttcctgcacacccagcagtggaag
ggggcctccaactacgtggcaaagcgctacatcgagtccgtggacagggacgtgtacttc
gaggacgtgcgtctacagatggaggccaagctctggggagaggagtataatcggcacaag
ccccccaagcaggtggacatcatgcagatgtgcatcatagagctgaaggagagaccgggc
cggccgctattccacctggaacactacatcgagggcaagtacatcaaatataactccaac
tcaggcttcgtccgtgatgacaacgtgcgcctgacgccacaggccttcagccacttcacg
tttgagcgttccggccaccagctgattgtggtggacatccagggcgtgggtgacctctat
accgacccacagatccacactgagaggggcactgactttggagatggaaacctaggtgtc
cgcgggatggctctcttcttccactcacatgcctgcaaccggatttgcaagagcatgggc
ctcactccctttgacctgtccccgagagagagggatgcagtgaatcagaacaccaagctg
ctgcagtcagccaagaccatcttaagggggacagaggaaaagtgcgggagcccccgggtg
aggaccctctcagggagccggcccccactgctgcttcgcctctcagagaactccggagat
gacaacatgagcgacgtgacctttgactctctcccttcctctccgtcttcagccacacca
catagccagaagctggagcacctccattggcctgtgttcagcgaccttgataacatggca
cctcgagaccaggaccctctggacaaccaccgggactctgagaacggtggggacagtgga
taccccagtgagaagcggggtgacctggatgacccagagcccagagaacatggccactca
aacggtaaccggaggtacgagtcggatgaagacagcctgggcagctccggacgggtctgt
gtggagaagtggaatctcttcaactcctcccgcctccacctgccgagaccttcggccgtg
gccctggaagtgcagaggctcaacgctctggacctcgagaagaaaatcgggaagtccatt
ttggggaaggtccatctggccatggtgcgctaccacgaggctggccgcttctgcgagaag
gacgaggagtgggaccgggagtcggcggtcttccacctggagcacgcagctgacctgggc
gagctggaggccatcgtgggcctgggactcatgtactcgcagctgccccaccacatcctg
gcggatgtctctctgaaggagacagaagagagcaaaaccaaaggatttgattacttactg
aaggcagctgaagctggggacagacagtgcatgattctggtggcacgagcctttgacact
ggccagaacctcagccctgacaggtcccagagctggccagaggctctccactggtacaac
actgccctggagacaactgactgtgatgagggtggggagtatgatgggatgcaagacgaa
ccccggtacatgctgctggccagggaggcggagatgctgttcacaggcggctgcgggctg
gagaaggacccacagagatcaggcgatttgtacacccaggcagccgaggcagcgatggaa
gccatgaagggccggctggccaaccagtactacgagaaagcagaggaggcctgggcccag
atggaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system