KEGG   Bos taurus (cow): 522960Help
Entry
522960            CDS       T01008                                 

Gene name
HIST1H2BJ
Definition
(RefSeq) histone cluster 1, H2bj
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    522960 (HIST1H2BJ)
  Immune diseases
   05322 Systemic lupus erythematosus
    522960 (HIST1H2BJ)
  Substance dependence
   05034 Alcoholism
    522960 (HIST1H2BJ)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    522960 (HIST1H2BJ)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   522960 (HIST1H2BJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 522960
NCBI-ProteinID: XP_002697546
BGD-bta: BT20174
Ensembl: ENSBTAG00000038277
UniProt: E1BGW2
Position
23
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggctaagtctgctccggccccgaaaaagggctccaagaaggcggtgact
aaggcgcagaagaaggacggcaagaagcgcaagcgcggccgcaaggaaagctactctatc
tacgtgtacaaggtgctgaagcaagtccacccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcctttgtaaacgacattttcgagcgcatcgcgggcgaggcatcgcgc
ctggcgcattacaacaagcgctcgaccatcacttccagggagatccagacggccgtgcgc
ctgttgctgcccggggagctggccaagcatgcggtgtccgagggcaccaaggctgtcacc
aagtacactagtgccaagtaa

DBGET integrated database retrieval system