KEGG   Bos taurus (cow): 522980Help
Entry
522980            CDS       T01008                                 

Gene name
USP2
Definition
ubiquitin specific peptidase 2 (EC:3.4.19.12)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     522980 (USP2)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   522980 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 606 aa AA seqDB search
MSQLSSTLKRYTESARFTDAPFTKSSYGTYTPSSYGTNLAASFLEKEKFGFKPSPPTSYL
TRPRTYGPPSILDYDRGRPLLRPDVIGGGKRAESQTRGTERPSGSGLSGGSGFSYGVTTS
SVSYLPVSARDQGVTLTQKKSNSQSDLARDFSSLQTSDSYRLDSGNLGRSPMLARTRKEL
CALQGLYQAASRSEYLADYLENYGRKASAPQVPTPTPPSRAPEVLSPTYRPSGRYSLWEK
GKGQALVSSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRL
YLRDLSHSSRAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQ
EFLRFLLDGLHNEVNRVIARPKSNTENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQL
KSSLTCTDCGYCSTVFDPFWDLSLPITKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRC
RARKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTAFVNFPLRDLDLREFASENTNHA
VYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVSPMSSSQVRTSDAYLLFYELA
SPPSRM
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccactctgaagcgctacacagaatcagcccgttttacagatgcg
cctttcaccaaatcaagctatggcacctatactccctcctcctacggaaccaacctggct
gcctccttcctggagaaggagaagtttggtttcaagcccagcccccccaccagctatctc
acccgtccccgtacctatggccccccctccatcctggactatgaccgaggccgccccctg
ctgagacctgacgtcatcgggggtggtaagcgggctgagagccagactcggggcaccgag
cggccttcagggagtggactcagcgggggcagtggattctcttatggagtgaccaccagc
tccgtcagctacctgcctgtcagtgcccgcgaccagggggtgaccctgacccagaagaag
tcgaacagtcaatcagacctggcccgggatttctccagcctccagacctcggatagctac
cggctggactctgggaacctgggccgcagccccatgctggcccgcacgcgcaaggagctg
tgcgccctgcagggcctgtaccaggcggccagccgctccgagtacctggccgactacctg
gagaactatgggcgcaaggccagcgcacctcaggtgcccaccccgacccctccctcacga
gcccccgaagtcctcagccccacctaccgacccagtggccgttacagtctgtgggagaag
ggcaagggccaggcccttgtgtccagccgctccagctccccagggcgagacaccatgaat
tctaagagcgcccagggtctggctggtcttcgaaaccttgggaacacgtgcttcatgaac
tccatcctacagtgcctgagtaacacgcgggagctgagagactactgcctgcagcggctc
tacctgcgggacctcagccacagcagccgtgctcacacggccctcatggaagagtttgca
aaactaatccagaccatatggacctcatcccccaatgacgtggtgagcccctctgagttc
aaaacccagatccagagatacgcaccacgcttcgtcggctataatcagcaggatgctcag
gagtttcttcgcttccttctggatgggctgcataatgaggtgaaccgggtcatagcgagg
cccaagtccaacactgaaaacctcgaccatctgcctgatgatgagaaagggcgccagatg
tggagaaagtatctagaacgggaagacagtcggatcggggatctctttgttgggcagctg
aagagctccctgacatgcactgattgtggctactgttctacggtctttgatcccttctgg
gacctctctctgcccattactaagcgaggttatcctgaggtgacgttaatggactgcatg
aggctcttcaccaaagaggacgtgcttgatggcgatgaaaagccgacgtgctgtcgctgc
cgagccagaaaacggtgtataaagaagttctccatccagaggttcccaaagatcttggtg
ctccatctgaagcggttctcagaatccaggatacgaaccagcaagctcacagcatttgtg
aatttcccactacgagacctggacttgagggaatttgcctcagaaaacaccaaccacgct
gtttacaacctgtacgccgtgtccaatcactccggaaccaccatgggcggccattacaca
gcctactgccggagcccggtgacaggcgagtggcacacgttcaacgactccagcgtctcc
cccatgtcctccagccaagtgcgtaccagcgacgcctacctgctcttctacgagttggcc
agtccgccctcccgcatgtag

DBGET integrated database retrieval system