KEGG   Bos taurus (cow): 523047Help
Entry
523047            CDS       T01008                                 

Gene name
SUV39H1
Definition
suppressor of variegation 3-9 homolog 1 (Drosophila) (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    523047 (SUV39H1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     523047 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 412 aa AA seqDB search
MAESLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagtttaaaaggctgcagtgtgtgttgcaaatcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgcccttggcatctccaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaaaaagatccgcgaacaggagtattac
ctggtaaaatggcgtgggtacccagactccgagagcacttgggaaccacggcagaatctc
aagtgtgtgcgcattctcaagcagttccacaaggacttggaaagggagctgctccggcgg
caccaccggtcaaagccaccccggcacctggacccaagcctggccaactacctggtgcag
aaggccaagcagaggcgggcactccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcaccgtggagaacgaagtggacctggatggccccccacgggccttc
gtgtacatcaacgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcaccggccggaggctgctgccctggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcgcctgcgagccgggctgcccatctat
gagtgcaactcccgctgccgctgtggctatgactgccccaaccgcgtggtacagaagggc
atccgctacgacctctgcatcttccgcacggatgatggacgcggctggggtgtccgcacg
ctggagaagatccgcaagaacagtttcgtcatggagtacgtgggcgagatcattacctca
gaggaggcagagcggcggggccagatctatgaccgccagggtgccacctacctcttcgac
ctggactacgtggaggatgtgtacactgtggacgccgcctattacggcaacatctctcac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcggctgccccgcattgctttctttgccaccagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggacccggtggacatggagagcacacgcatggac
tccaactttggcctggctgggctccccggctctcccaagaagcgggtccgcattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system