KEGG   Bos taurus (cow): 523047Help
Entry
523047            CDS       T01008                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (EC:2.1.1.43)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    523047 (SUV39H1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     523047 (SUV39H1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     523047 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    523047 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 412 aa AA seqDB search
MAESLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagtttaaaaggctgcagtgtgtgttgcaaatcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgcccttggcatctccaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaaaaagatccgcgaacaggagtattac
ctggtaaaatggcgtgggtacccagactccgagagcacttgggaaccacggcagaatctc
aagtgtgtgcgcattctcaagcagttccacaaggacttggaaagggagctgctccggcgg
caccaccggtcaaagccaccccggcacctggacccaagcctggccaactacctggtgcag
aaggccaagcagaggcgggcactccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcaccgtggagaacgaagtggacctggatggccccccacgggccttc
gtgtacatcaacgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcaccggccggaggctgctgccctggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcgcctgcgagccgggctgcccatctat
gagtgcaactcccgctgccgctgtggctatgactgccccaaccgcgtggtacagaagggc
atccgctacgacctctgcatcttccgcacggatgatggacgcggctggggtgtccgcacg
ctggagaagatccgcaagaacagtttcgtcatggagtacgtgggcgagatcattacctca
gaggaggcagagcggcggggccagatctatgaccgccagggtgccacctacctcttcgac
ctggactacgtggaggatgtgtacactgtggacgccgcctattacggcaacatctctcac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcggctgccccgcattgctttctttgccaccagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggacccggtggacatggagagcacacgcatggac
tccaactttggcctggctgggctccccggctctcccaagaagcgggtccgcattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system