KEGG   Bos taurus (cow): 523311Help
Entry
523311            CDS       T01008                                 

Gene name
GPX7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    523311 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    523311 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    523311 (GPX7)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     523311 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 186 aa AA seqDB search
MVAARAAAWLLLAAAACAPREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTETSGKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQITALVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcacgggcggcggcgtggctgctcctggctgcggcggcctgcgcgccgcgg
gagcaggacttctacgacttcaaggccgtcaacatccggggcaagttggtgtcgctggag
aagtaccgaggctcggtgtccctggtggtgaacgtggctagcgagtgtggcttcacagac
cagcactatcgggccctgcagcagctgcagcgggacctggggccccaccacttcaatgtg
cttgccttcccctgcaaccagtttggccagcaggagcccgacagcaacaaggagatcgag
agctttgcccgccgcacatacagtgtctctttccccatgtttagcaagattgcagtcacc
ggcactggtgcccaccctgccttcaagtacctgactgagacttctgggaaggagcctacc
tggaacttctggaagtacctggtggccccagatggaaaggtgataggagcttgggaccca
actgtgtcggtggaggaaatcaggccccagattacagcgcttgtgaggaaactcatcctg
aagaagcgagaagacttataa

DBGET integrated database retrieval system