KEGG   Bos taurus (cow): 523458Help
Entry
523458            CDS       T01008                                 

Definition
(RefSeq) histone H2B 1/2
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    523458
  Immune diseases
   05322 Systemic lupus erythematosus
    523458
  Substance dependence
   05034 Alcoholism
    523458
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    523458
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   523458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF ATG22 MCPsignal CENP-W
Motif
Other DBs
NCBI-GeneID: 523458
NCBI-ProteinID: XP_002699901
BGD-bta: BT23791
Ensembl: ENSBTAG00000014287
UniProt: G3MZF9
Position
X
AA seq 163 aa AA seqDB search
MAQPSSDNSEEDPGTNEAGTSKTEPSETEPSETETSESEPSEPEPYDAKPKKAKRKTAKG
RRHRRRCHQDNFASFATYFRRVLKQVHTGLSLSHEAMNVMHSFVKHMFEQIAEEAGSLAH
SSKHCTITSGEIQRAVRLLLPGEIGKHAVSEATKSVIRYNTRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccatcctctgacaactctgaggaagaccctggcaccaacgaagccggaacc
tccaaaacagagccctctgaaacggagccctctgaaacagagacctcagaatcggagccc
tccgaaccggagccctatgacgctaagccaaagaaggcgaaacggaagacagctaagggc
cgccgccaccgccgccgctgccatcaggacaactttgcaagcttcgccacctatttccgc
agggtgctgaagcaagtgcacacaggcctgagtctctctcacgaggccatgaacgtcatg
cattcgttcgtgaagcatatgtttgagcagatcgccgaagaggccgggagcctggcccac
tccagcaagcactgcaccatcacgagtggagagatccagagagccgtgcgtcttctcttg
cctggggagatcggcaagcacgcagtgtccgaggccaccaagtcggtcatcagatacaac
acccgcagatga

DBGET integrated database retrieval system