KEGG   Bos taurus (cow): 523702Help
Entry
523702            CDS       T01008                                 

Definition
(RefSeq) histone H2B type 1-L
  KO
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    523702
  Immune diseases
   05322 Systemic lupus erythematosus
    523702
  Substance dependence
   05034 Alcoholism
    523702
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    523702
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   523702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 122 aa AA seqDB search
MPELAKSAPAPKKGSKKAVTKAQKKDGKKHKHNRKENHSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFEPIAGEASHLVHYYKRSTITSREIQTAVRLLLLGELGKHAMSEGTKAVT
KC
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc
aaggcccagaagaaggacggcaagaagcacaagcacaaccgcaaggagaaccactccgtg
tacgtgtacaaggtgctgaagcaagtccatccggacaccggcatctcgtcgaaggccatg
ggaatcatgaactccttcgtcaacgacatttttgagcccatcgctggtgaggcatcgcac
ctggtgcattactacaagcgctcaactatcacatccagggagatccagactgccgtgcgc
ttgctgctacttggggagctgggcaagcatgccatgtctgagggcactaaggctgtcacc
aaatgttga

DBGET integrated database retrieval system