KEGG   Bos taurus (cow): 523707Help
Entry
523707            CDS       T01008                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:bta04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
13
AA seq 1411 aa AA seqDB search
MSGLGENALDPLAPDSRKRKLPCDPPGQGLACSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAITSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKIPHDILEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSSPESFITRHDLSGKVITIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCNSSVGGMSMSPNPGLQMLSSRTYGL
TDAGTAGQMSGARYGASGSIASMNPGPGMQSPSSYQNSTYGLNMSSPPHGSPGLGSSQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTVSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHINDKESK
ESGVEGSENQRAPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEG
NVKQEQLSPKKKESNALLRYLLDRDDPSDTLAKELQPKVEGVDSKMSQCSSSAIPSSSQE
KDAKIKTETNEEGSGDLDNLDAILGDLTNSDFYNNSIPTSGSNLGTKPQMFQGANSLGLR
SPQPVQSVRPPYNRAVSLDSPVSVGSSPPVKNIGAFPMLPKQPMLGGNPRMMDNQENYGS
NMGGPNRNVTVNQAPSSGDWGLPSSKASRMEPVNSNAMGRPGTDYNASLPRPAMGGSMPA
MPLRSNSIPGARPVMQQQQQQQPQPQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGM
LSMEQGPHGTQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDR
ALGIPELVNQGQALEPKQDAFQGQEAAVMMEQKAALYGQTYPGQGPPMQGGFNLQGQSPP
FNSMMNQMNQQGSFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMK
MENPTAGGATAMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQ
QQQTQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPSNYGMGQQPDPAFGRVPSPPN
AMMSSRMGPSQNPMMQHPQTAPMYQSSEMKGWPSGTLARNSTFPQQQFAHQGNPAAYSMV
HMNGSGGPMGQMNMNAMPMAGMPMGPDQKYC
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaacgccttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatcctccagggcaaggccttgcctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactaatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctattaccagtgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccactcttacttcag
gcattggacggcttcctatttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgttacccagtacctacaatataagcaagaggacctggttaatacaagtgtctacaat
atattgcatgaagaagatagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagttacctggacaaatgagacccagagacaaaaaagccatacatttaactgccgtatg
ttgatgaaaataccacatgacattctggaagacataaacaccagtcccgaaatgcgccag
agatacgagacgatgcagtgctttgccctgtcccagccgcgggctatgatggaggaaggg
gaagacttgcagtcctgtatgatctgtgtggcacgccgcattaccactggagaaagagca
tttccatcaagtcctgagagctttatcactagacacgatctttcagggaaagttattact
atagacaccaattcactgagatcctccatgagacctggctttgaagacataatccgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccgctgtatcgattctctttggctgat
ggcactatagtgactgcgcaaacaaaaagcaaactattccgaaatcctgtaacaaatgac
cgtcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccgaatcctgttggacaaggcattaggcctccagcagctggatgcaacagttcagtaggc
ggcatgagtatgtcaccaaatccaggcttacagatgctgagcagcaggacttacggctta
actgatgctggcaccgcggggcagatgagtggagccaggtatggggcttccggtagcata
gcctccatgaaccccgggccaggcatgcagtcaccatcttcctaccagaacagtacctac
ggtctcaacatgagtagccctccacacgggagccctggtctcggctccagccagcagaat
atcatgatttctcctcgtaatcgagggagtccaaagatggcctcacaccagttttctcct
gttgcaggcgtgcactctcccatgggatcttctggcaataccgtgagtcacagcttttct
agcagctctctgagtgcccttcaagctatcagtgagggcgtggggacttctcttttatct
acactgtcttcgccaggtcccaaattggataattcccctaatatgaatataactcaacca
agtaaagtgaacagtcaggattccaagagtcccctaggcttgtattgcgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacattaacgacaaagaaagtaag
gagagcggtgtggaagggtctgagaatcagcgggctcctctggaaagcaaaggtcacaaa
aagttgctgcagttactcacctgttcttctgatgaccggggtcattcctccttgaccaac
tcccccctggactcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcctcttccacctccggaggtgtatcctccacatccaacatgcatgggtcactgctgcaa
gagaagcaccggattttgcacaagttgctccagaatggaaattcaccagcagaagtagcc
aagattaccgctgaagccactgggaaggacaccagcagtacgacgtcttgtgtagaagga
aacgtcaagcaggagcaactcagtcctaagaaaaaggaaagtaatgctctgcttaggtat
ctgctggacagggacgatcctagtgacacacttgccaaagagctccagcccaaagtggaa
ggcgtggacagtaagatgagtcagtgcagcagctccgccattccgagctcaagtcaagag
aaagatgctaaaattaagacagaaacaaatgaagagggatccggagacttggataatcta
gatgctattcttggtgatctgactaattctgacttctacaataattccatacccacaagt
ggtagtaacctgggaactaagccacagatgtttcaaggagctaattctctgggtttgagg
agtccgcagcctgtacagtctgtccgtcctccgtataaccgggcagtatctctagacagt
cctgtttccgttggctcaagtcctccagtaaagaatattggtgctttccccatgttacca
aagcaacccatgttgggcggcaatccaagaatgatggataatcaggaaaattacggctca
aatatgggtgggccaaacagaaatgtgactgtgaatcaggcgccttcctcaggagattgg
ggcttaccgagctccaaggccagccgcatggaacctgtgaattcaaatgccatggggaga
ccaggaactgattataatgcttctttacccagacctgccatgggtggctcgatgcccgcc
atgccacttcggtccaatagcatcccaggtgcgagaccagtgatgcagcagcagcagcag
cagcagccacagccacagatgcttcagatgcggcctggtgagattcccatggggatgggg
gtcagtccttatggccaagcagcaccatcaaaccaacctggttcctggccagatggcatg
ttgtccatggaacaaggccctcatgggacccaaaataggccaattcttaggaattccctg
gatgatctccttgggccaccttctaacctagaaggccagagtgatgaaagagcactgttg
gaccagttgcacacactcttgagcaacacagatgccacaggcctggaagagattgacaga
gctctgggcattcctgaacttgtaaatcagggacaagcgttggagcccaaacaggacgct
ttccaaggccaagaagcagcagtaatgatggagcagaaggcagcattatacgggcagaca
tacccggggcaggggcctccgatgcaaggaggctttaatcttcagggacagtcaccacct
tttaactcgatgatgaatcagatgaaccagcaaggcagttttcctctccaaggaatgcac
cctcgggccaacatcatgagaccccgaacaaacactcccaagcaacttagaatgcagctt
cagcagaggctgcagggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaa
atggaaaaccccactgctggcggggcaacggcgatgaggcccatgatgcagccgcaggtc
aactcccagcagggtttccttaacgctcagatggttgcccagcgcagcagagagctgctg
agtcatcacttccggcagcagagggtggcgatgatgatgcaacagcagcagcaacagcag
cagcagcaaacccaggccttcagtccacccccgaatgtgactgcgtcccctagcatggat
ggggtcctggctgggcctgccatgccgcaagctccaccccagcagtttccatacccttca
aattacgggatgggacaacaaccagatccagcctttggtcgagtgcctagtcctcccaat
gcgatgatgtcatcaagaatgggtccttcccagaatcccatgatgcagcatcctcagacc
gcacccatgtatcagtcatcagaaatgaagggctggccgtcaggaaccctggcccggaac
agcacctttccccagcagcagtttgcccaccaggggaatcctgcagcgtacagtatggtg
cacatgaacggcagcggtggtcccatgggacagatgaacatgaacgccatgcccatggct
ggcatgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system