KEGG   Bos taurus (cow): 523707Help
Entry
523707            CDS       T01008                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    523707 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    523707 (NCOA3)
   05224 Breast cancer
    523707 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    523707 (NCOA3)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     523707 (NCOA3)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    523707 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
Position
13
AA seq 1411 aa AA seqDB search
MSGLGENALDPLAPDSRKRKLPCDPPGQGLACSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAITSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKIPHDILEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSSPESFITRHDLSGKVITIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCNSSVGGMSMSPNPGLQMLSSRTYGL
TDAGTAGQMSGARYGASGSIASMNPGPGMQSPSSYQNSTYGLNMSSPPHGSPGLGSSQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTVSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHINDKESK
ESGVEGSENQRAPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEG
NVKQEQLSPKKKESNALLRYLLDRDDPSDTLAKELQPKVEGVDSKMSQCSSSAIPSSSQE
KDAKIKTETNEEGSGDLDNLDAILGDLTNSDFYNNSIPTSGSNLGTKPQMFQGANSLGLR
SPQPVQSVRPPYNRAVSLDSPVSVGSSPPVKNIGAFPMLPKQPMLGGNPRMMDNQENYGS
NMGGPNRNVTVNQAPSSGDWGLPSSKASRMEPVNSNAMGRPGTDYNASLPRPAMGGSMPA
MPLRSNSIPGARPVMQQQQQQQPQPQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGM
LSMEQGPHGTQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDR
ALGIPELVNQGQALEPKQDAFQGQEAAVMMEQKAALYGQTYPGQGPPMQGGFNLQGQSPP
FNSMMNQMNQQGSFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMK
MENPTAGGATAMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQ
QQQTQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPSNYGMGQQPDPAFGRVPSPPN
AMMSSRMGPSQNPMMQHPQTAPMYQSSEMKGWPSGTLARNSTFPQQQFAHQGNPAAYSMV
HMNGSGGPMGQMNMNAMPMAGMPMGPDQKYC
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaacgccttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatcctccagggcaaggccttgcctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactaatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctattaccagtgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccactcttacttcag
gcattggacggcttcctatttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgttacccagtacctacaatataagcaagaggacctggttaatacaagtgtctacaat
atattgcatgaagaagatagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagttacctggacaaatgagacccagagacaaaaaagccatacatttaactgccgtatg
ttgatgaaaataccacatgacattctggaagacataaacaccagtcccgaaatgcgccag
agatacgagacgatgcagtgctttgccctgtcccagccgcgggctatgatggaggaaggg
gaagacttgcagtcctgtatgatctgtgtggcacgccgcattaccactggagaaagagca
tttccatcaagtcctgagagctttatcactagacacgatctttcagggaaagttattact
atagacaccaattcactgagatcctccatgagacctggctttgaagacataatccgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccgctgtatcgattctctttggctgat
ggcactatagtgactgcgcaaacaaaaagcaaactattccgaaatcctgtaacaaatgac
cgtcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccgaatcctgttggacaaggcattaggcctccagcagctggatgcaacagttcagtaggc
ggcatgagtatgtcaccaaatccaggcttacagatgctgagcagcaggacttacggctta
actgatgctggcaccgcggggcagatgagtggagccaggtatggggcttccggtagcata
gcctccatgaaccccgggccaggcatgcagtcaccatcttcctaccagaacagtacctac
ggtctcaacatgagtagccctccacacgggagccctggtctcggctccagccagcagaat
atcatgatttctcctcgtaatcgagggagtccaaagatggcctcacaccagttttctcct
gttgcaggcgtgcactctcccatgggatcttctggcaataccgtgagtcacagcttttct
agcagctctctgagtgcccttcaagctatcagtgagggcgtggggacttctcttttatct
acactgtcttcgccaggtcccaaattggataattcccctaatatgaatataactcaacca
agtaaagtgaacagtcaggattccaagagtcccctaggcttgtattgcgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacattaacgacaaagaaagtaag
gagagcggtgtggaagggtctgagaatcagcgggctcctctggaaagcaaaggtcacaaa
aagttgctgcagttactcacctgttcttctgatgaccggggtcattcctccttgaccaac
tcccccctggactcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcctcttccacctccggaggtgtatcctccacatccaacatgcatgggtcactgctgcaa
gagaagcaccggattttgcacaagttgctccagaatggaaattcaccagcagaagtagcc
aagattaccgctgaagccactgggaaggacaccagcagtacgacgtcttgtgtagaagga
aacgtcaagcaggagcaactcagtcctaagaaaaaggaaagtaatgctctgcttaggtat
ctgctggacagggacgatcctagtgacacacttgccaaagagctccagcccaaagtggaa
ggcgtggacagtaagatgagtcagtgcagcagctccgccattccgagctcaagtcaagag
aaagatgctaaaattaagacagaaacaaatgaagagggatccggagacttggataatcta
gatgctattcttggtgatctgactaattctgacttctacaataattccatacccacaagt
ggtagtaacctgggaactaagccacagatgtttcaaggagctaattctctgggtttgagg
agtccgcagcctgtacagtctgtccgtcctccgtataaccgggcagtatctctagacagt
cctgtttccgttggctcaagtcctccagtaaagaatattggtgctttccccatgttacca
aagcaacccatgttgggcggcaatccaagaatgatggataatcaggaaaattacggctca
aatatgggtgggccaaacagaaatgtgactgtgaatcaggcgccttcctcaggagattgg
ggcttaccgagctccaaggccagccgcatggaacctgtgaattcaaatgccatggggaga
ccaggaactgattataatgcttctttacccagacctgccatgggtggctcgatgcccgcc
atgccacttcggtccaatagcatcccaggtgcgagaccagtgatgcagcagcagcagcag
cagcagccacagccacagatgcttcagatgcggcctggtgagattcccatggggatgggg
gtcagtccttatggccaagcagcaccatcaaaccaacctggttcctggccagatggcatg
ttgtccatggaacaaggccctcatgggacccaaaataggccaattcttaggaattccctg
gatgatctccttgggccaccttctaacctagaaggccagagtgatgaaagagcactgttg
gaccagttgcacacactcttgagcaacacagatgccacaggcctggaagagattgacaga
gctctgggcattcctgaacttgtaaatcagggacaagcgttggagcccaaacaggacgct
ttccaaggccaagaagcagcagtaatgatggagcagaaggcagcattatacgggcagaca
tacccggggcaggggcctccgatgcaaggaggctttaatcttcagggacagtcaccacct
tttaactcgatgatgaatcagatgaaccagcaaggcagttttcctctccaaggaatgcac
cctcgggccaacatcatgagaccccgaacaaacactcccaagcaacttagaatgcagctt
cagcagaggctgcagggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaa
atggaaaaccccactgctggcggggcaacggcgatgaggcccatgatgcagccgcaggtc
aactcccagcagggtttccttaacgctcagatggttgcccagcgcagcagagagctgctg
agtcatcacttccggcagcagagggtggcgatgatgatgcaacagcagcagcaacagcag
cagcagcaaacccaggccttcagtccacccccgaatgtgactgcgtcccctagcatggat
ggggtcctggctgggcctgccatgccgcaagctccaccccagcagtttccatacccttca
aattacgggatgggacaacaaccagatccagcctttggtcgagtgcctagtcctcccaat
gcgatgatgtcatcaagaatgggtccttcccagaatcccatgatgcagcatcctcagacc
gcacccatgtatcagtcatcagaaatgaagggctggccgtcaggaaccctggcccggaac
agcacctttccccagcagcagtttgcccaccaggggaatcctgcagcgtacagtatggtg
cacatgaacggcagcggtggtcccatgggacagatgaacatgaacgccatgcccatggct
ggcatgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system