KEGG   Bos taurus (cow): 524075Help
Entry
524075            CDS       T01008                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 343 aa AA seqDB search
MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHN
DVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLLFDGRTNPAH
PKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINASNSKQPIHMVYVPSH
LYHMLFELFKNAMRATVESHESSVTLPPVKVMVALGEEDLSIKMSDRGGGVPLRKIDRLF
SYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALS
TDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagatcaacctgcttcctgaccgggtgctgagcacaccctcggtgcagctggta
cagagctggtatgtccagagtctcctggacatcatggagttcctggacaaggaccctgag
gaccatcggaccctgagccagttcactgacgccctggtcaccatccggaaccgccacaat
gacgtggtgcccacaatggctcagggcgtgctggagtacaaggacacctatggcgatgac
cccgtctccaaccagaacatccagtacttcctggaccgcttctacctcagccgcatctcc
atccgcatgctcatcaaccagcacaccctgctctttgacggcagaaccaaccctgcccac
cccaaacacatcggcagcatcgaccccaactgcaatgtctctgaggtggtgaaggatgcc
tacgacatggccaagctcctgtgtgacaagtattacatggcctctcctgacctggagatc
caggagatcaacgcatccaactccaaacagccgattcacatggtctatgtcccctcccac
ctctaccacatgctttttgaactcttcaagaatgccatgcgggcgactgtggaaagccat
gagtccagcgtcactcttccgcctgtcaaggtcatggtggccttgggcgaggaggacctt
tccatcaaaatgagtgaccgaggtgggggtgttcctttgaggaagattgatcgactcttc
agttacatgtactccacagcccccacgccccagcccggcaccgggggaaccccactggct
ggcttcgggtatgggctccccatttcccgcctctatgccaagtacttccagggggacctg
cagctcttctccatggagggctttgggaccgacgctgtcatctatctcaaggccctgtcc
acggactcagtggagcgtctgcctgtctacaacaagtcagcctggcgccactaccagacc
atccaggaggccggcgattggtgtgtgcccagcacggagcccaagaacacgtccacgtac
cgtgtcagctag

DBGET integrated database retrieval system