KEGG   Bos taurus (cow): 524531Help
Entry
524531            CDS       T01008                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
1
AA seq 1054 aa AA seqDB search
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDAQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNVQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEDKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPSSG
SVPSQTLPSTTDQQGAPSSELPSTSPASIAAISSRSVIHKPFTQSRIPPDLPMHPAPRHI
TEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHE
GQANAGHYWAYIFDHRENRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKPQ
FLIQEEFNKETGQALVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQ
KLRESESSVTTAQAGEPEYLEQPSRSDFSKHLKEETIRIITKASHEHEDKSPETVLQSAI
KLEYSRLVKLAQEDTPPETDYRLHHVIVYFIQNQAPKKIIEKTLLEQFADRNLSFDERCH
NIMKVAQAKIEMIKPEEVNMEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLI
CAYQNNKELLSRGPYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEF
IVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMESNLQEKLTDFLPKLLDCSTEIKG
FHEPPKLPPYSTHELCERFTRIMLSLSRTPADGR
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaacgtgctgcagcagagcgcggcgcagaagcaccagcagacgttt
ctgaatcaactacgagaaattacggggattaatgatgcccagattctacagcaagccttg
aaggatagtaatggaaacttggagctagcagtggctttccttactgcaaagaatgccaag
acccctcagcaggaggagacaacttactaccaaacagcgcttcctggcaatgacagatac
atcagtgtgggcagccaagcggacacaaatgtgattgatcttactggagatgataaagat
gatcttcagagagcaattgccttgagtttggcggaatcaaacagggcattcagggagact
ggaataactgatgaggagcaagccattagcagagttcttgaggccagcatagcagaaaat
aaagcatgtttgaagaggacacctactgaagtttggagagattctcgaaacccttacgat
agaaaaaggcaggacaaagctcctgttggactaaagaatgttggcaatacttgctggttt
agtgctgttattcagtcattattcaatcttttggaattcagaagattagttctgaattac
aagcctccatcaaatgttcaagatttaccccgaaaccaaaaggagcatcggaatttgcct
tttatgcgtgagcttcgatatctatttgcacttcttgttggtactaaaaggaaatatgtt
gatccatcaagagcagttgagattcttaaagatgctttcaaatcaaatgactcccagcag
caagacgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatg
aaagctgaagaagagacggatgaagacaagccaaagaaccccatggtagagttgttctat
ggaagattcctagctgtgggagtgcttgaaggtaaaaaatttgaaaatactgaaatgttt
ggtcagtacccacttcaggtcaatggatttaaagatctacatgaatgcctagaagctgct
atgattgaaggagaaattgagtctttacattcagaaaattcaggaaaatctggtcaagag
cattggtttactgaactcccacctgtgttaacatttgaattgtcaagatttgaatttaat
caggcactgggaagaccagaaaaaattcacaataaattagaatttcctcaagttttatat
ctggacagatacatgcatagaaacagagaaataacaagaattaagagggaagagatcaag
agactaaaagattacctcacagtattacaacaaagacttgaaaggtatttaagctatggt
tcgggtcccaaacggtttcccttggtggatgttctgcagtacgccttagaatttgcctca
agtaaacctgtttgcacttctcctgttgatgatattgatgctagttccccatctagtggt
tccgtaccatcacagacattaccaagcacaacagaccaacagggagctccttcttcagaa
ctgccaagcacgtcacccgcgtcaatagctgccatttcatcaagatcagtaatacacaaa
ccattcactcagtctcggatacctccagacttgcccatgcatccggcaccaaggcacata
acagaagaagaactctctgtgctagaaagctgtttacatcgctggaggacagaaatagaa
aatgacaccagagatttacaggaaagcatatctagaatccatcgcacaattgagctaatg
tactctgacaaatctatgatccaagttccttatcgtttacatgctgttttagttcatgaa
ggtcaagctaatgccgggcactactgggcatacatttttgatcatcgtgaaaacaggtgg
atgaagtacaatgatattgctgtaacaaaatcatcatgggaagagctagtgagggattct
tttggtggttacagaaatgccagtgcatactgtttaatgtacataaatgacaaaccacaa
ttcttaatacaagaggagtttaataaagaaactgggcaggcccttgttggaatagaaaca
ctaccccctgacttaagagattttgttgaggaagacaaccagcgatttgagaaagaacta
gaagaatgggatgcacaacttgctcagaaagccttgcaggaaaaacttctagcatctcag
aaattgagagagtccgagtcttctgtgacaacagcacaagcaggagaaccagaatatcta
gagcagccatcaagaagtgatttctcaaagcacttgaaagaagaaaccattcgaataatt
accaaggcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcggcaatt
aagttggaatattcaaggttggttaaattggcccaagaagataccccaccagaaacagac
tatcgtttacatcatgtaatagtctactttatccagaatcaggctccaaagaaaatcatt
gagaaaacattgctagaacaatttgcagatagaaatttgagttttgatgaaaggtgtcac
aacataatgaaagttgctcaagccaaaattgaaatgataaaacctgaagaagtaaacatg
gaggagtatgaggagtggcatcaggattatagaaaattcagggaaacaaccatgtatctc
attattgggctagaaaattttcaaagagaaagttatatagattccttgctcttccttatc
tgtgcttatcagaataacaaagaactgttgtccagaggcccatacagaggacatgatgaa
gaattgatatcacattatagaagagaatgtttactaaaattaaatgagcaagctgcagaa
ctgtttgaatctggagaggatagagaagtaaacaatggtctgattatcatgaatgaattt
attgtcccatttttgcccttgttattggtggatgaaatggaagagaaagacatacttgct
gtggaagatatgagaaatcgatggtgttcctatcttggacaagaaatggaatcaaacctc
caagagaagctgacagattttctgccaaagctgcttgattgttctacggagattaaaggt
ttccatgagccgcctaagttacctccgtactccacacacgaactctgtgagcgatttacc
cgaatcatgctgtccctcagtcgaactcctgctgatggaagataa

DBGET integrated database retrieval system