KEGG   Bos taurus (cow): 524957Help
Entry
524957            CDS       T01008                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    524957 (RASGRF2)
   04010 MAPK signaling pathway
    524957 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1144 aa AA seqDB search
YYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVET
EKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFM
RGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMA
ASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIY
QEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLH
ELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDT
SQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLL
KTGGVLSLIECTLVEEPDASDDDSKGSGQVFGHLDFKIVVEPADAAPFTVVLLAPSRQEK
AAWTSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKV
PQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVR
SLELFFATSQNNRGEHLVEGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIG
ALDLTTSSASSSPTTTHSPAASPPPHTGKVPLDLSRGLSSPEQSPGSVEESVDNPRVDLC
NKLKRSIQRAAVLESAPVDRAGVDSSPVADAAELSPCRSPSTPRHLRYRQPGGQTADNSH
CSVSPASAFAIATAAAGHGSPPGFNNSERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDF
ELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQLTDCP
KAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDM
SNLVASQIMNYADVTSRANTIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWA
KVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTE
EGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKALIIDEDTLYELSLKIEP
RLPA
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
tattactttactgttctttttggccatgaaggtcagaagccactagagctgcgctgtgag
gaggagcaggatggtaaagagtggatggaggccattcaccaagccagttatgcagacatt
ttgattgagagggaagtattaatgcagaagtacattcatctagttcagatcgtagagaca
gaaaaaattgcagctaaccaactccggcatcaacttgaagatcaagacacagaaatcgaa
aggcttaaatcagagattatcgctcttaataaaacaaaggaacgaatgagaccttaccaa
agcaatcaagaagatgaggatccagacatcaagaagataaaaaaggttcagagcttcatg
agagggtggttatgtagaaggaaatggaagaccatcgtgcaggattacatttgttctcct
cacgccgaaagcatgaggaagagaaaccagatcgtgttcaccatggtggaggccgagtcg
gagtacgttcaccagctctacatcctcgtcaatggcttcctgaggcccctgcgcatggcg
gccagctccaagaagccccccatcagccacgacgacgtcagcagtatttttctcaacagt
gaaacaatcatgtttcttcacgaaatatttcatcaaggactgaaggcaagaatagccaac
tggcctactttaattttagctgatctgtttgatattttgctccccatgctgaacatttat
caagaatttgtgcgtaatcaccagtacagcctccaagtgctcgccaattgtaagcaaaac
agagactttgacaaactcttaaaacagtatgaagccaaccctgcctgtgaggggaggatg
ctggagacgttcttgacatatccaatgtttcagatccccaggtatatcatcacgcttcat
gaactcctggctcatacaccccatgagcacgtggagagaaaaagtctggagtttgcgaaa
tccaaactagaggaactgtccagggtcatgcatgatgaagtgagtgacaccgaaaacata
aggaagaaccttgccatagaaagaatgatcgtcgagggctgtgatattttgctggacacc
agccagactttcatccgccaaggttctcttattcaagtaccttccgttgagagagggaaa
cttagtaaagttcgcctgggttcactgtctttgaaaaaggaaggagaaagacagtgcttc
ttgtttacaaaacactttttaatttgtacaagaagttcaggaggaaagctgcatctgctc
aagacaggtggagttctgtctctaatagaatgtaccttggttgaggagcccgatgcgagc
gatgatgactccaaaggttctggccaagtgtttggacacttggatttcaaaatagtggtg
gagcctgcagatgctgcccctttcactgtggtcttgttagcaccttcccgccaggagaaa
gctgcctggacaagcgacatcagtcagtgtgtggacaacatacggtgtaatggtttaatg
actatagtgtttgaagaaaattccaaagttactgtgccacatatgattaagtctgacgcc
cggcttcacaaggacgacactgacatttgcttcagtaaaaccctcaactcctgcaaagtg
ccgcagatccggtatgccagcgtggagcgcctcttggagagactgaccgacttgcggttt
cttagcatcgatttcctcaacacctttctgcacacctatcggattttcacgacagcagct
gtggtgctggggaagctttctgacatatataagaggcctttcacctccatccctgtcagg
tcattggaactcttttttgctaccagccagaacaacagaggtgaacacttggtggaaggc
aaatccccacgcctgtgtcgcaaattctcttccccacctccactggctgtgtccaggacg
tcctccccagtgagggccagaaagctgtccttgacttctcccttgaattcaaggataggc
gcactggatctgaccacctcctcagcatccagcagccccaccaccacccacagcccagct
gcatccccaccgcctcacactggtaaagtgccgttggatctgagcagaggcctttcttct
ccagaacaaagcccgggatctgtagaggagtctgttgataacccccgtgtggatctgtgt
aacaagctaaaacgaagtattcagagagcagcagtcctcgagtctgcgccggtggaccga
gcaggtgtggacagctcacccgtagccgatgccgcagaactgtcaccttgcaggtcaccc
tcaactcctcggcacctccgctaccgccagcctggaggacagacggctgacaactcccac
tgctctgtttcaccggcctctgcttttgcaatcgctacagctgcagcaggacacgggagt
ccacccggatttaacaactccgagagaacatgcgacaaagagtttattatacgtagaaca
gccaccaatcgagtactgaacgttctccgtcactgggtctcaaagcacgcacaggacttt
gaactcaacaatgaactaaagatgaacgtcttaaatttgctagaagaagttttacgagac
ccagatcttcttccccaagaacggaaagccacagcgaacatcctaagggccctttcacaa
gatgatcaagatgacatccacctaaaactagaggatataattcagctgacggactgtccg
aaggccgagtgcttcgagaccttgtcggccatggagctggctgagcagataaccctcctg
gaccacatcgttttcagaagcattccctacgaagaatttcttgggcaggggtggatgaag
ctggataaaaatgaaagaacaccatacattatgaaaaccagccaacacttcaatgatatg
agtaacctggtggcctcccagatcatgaattacgcggatgtcacctcccgagccaacacc
atcgagaagtgggtggcggtggcggacatctgccggtgcctgcacaattacaacggcgtg
ctggagatcacctcagccttaaacagaagtgccatctaccggctgaagaagacctgggcc
aaggtgtccaagcagacaaaagctctaatggacaagcttcagaagactgtttcgtctgaa
ggaagatttaaaaacctcagagaaacccttaaaaattgtaaccccccggctgttccttat
ctggggatgtacctgacagacctggcgttcattgaagaaggaacaccaaactttaccgag
gaaggcctcgtcaatttctccaagatgagaatgatatcacacatcatcagagagatacgc
cagttccagcagacttcctatcgaatcgatcatcagccaaaggtcactcagtacttgctt
gacaaagccctcatcatagatgaagatacgctgtatgagctgtcactaaaaattgaacct
cggctccctgcttga

DBGET integrated database retrieval system