KEGG   Bos taurus (cow): 525512Help
Entry
525512            CDS       T01008                                 

Gene name
HIST1H2BB
Definition
histone cluster 1, H2bb
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    525512 (HIST1H2BB)
  Immune diseases
   05322 Systemic lupus erythematosus
    525512 (HIST1H2BB)
  Substance dependence
   05034 Alcoholism
    525512 (HIST1H2BB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   525512 (HIST1H2BB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
23
AA seq 126 aa AA seqDB search
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccgtctaaatctgctccggctcctaaaaaaggctctaagaaagccatcact
aaggcacagaagaaagatggcaaaaaacgcaagcgcagtcgtaaagagagctactctatt
tatgtgtacaaggttctgaagcaggtccatccagatactggtatctcatctaaggccatg
ggtatcatgaactccttcgtgaacgacattttcgagcgcatcgccagcgaggcgtcacgc
ctggcgcattacaacaagcgctcgaccattacatcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcatgctgtttctgagggtaccaaggccgtaact
aaatacaccagctccaaatga

DBGET integrated database retrieval system