KEGG   Bos taurus (cow): 525702Help
Entry
525702            CDS       T01008                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
29
AA seq 1022 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAARQPLEREQCLALLALGTRLYVSGADELPRRV
GCQLLHVAGRHHPEVFAEFFSARRVLRLLQGGAGPPSARALACVQLCLQLLPEGPGADEV
FALLRREVLRTVCERPGPAVCAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLAKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSSPSPPEEPPGPSATSVEKMFGGKIVTRICCLRCLNVSSREEAFTDLSLAF
PPPERCRRHHHHHHHRRRRLGSVMLPAEDAGAQEPGSAGPRRQRKHCITGGVPPTILDME
GLGPHGLGGQSGQEEKVERGESTEEEEAAGEEEEEEEEEKVKAEVEEKVEEEKVKEEEKV
KEKEKEKEAQEEKEAAADGEEAAAGPGPGTLQSAAAASGDGSRSVLDLVNYFLSPERLTS
ENRYHCESCASLQDAEKVVELSQGPRYLILTLLRFSFDLRTMRRRKILDDVSVPLLLRLP
LAGGRGQAYDLCSVVVHSGLSSESGHYYCYAREGAARPAPALGAAERPEPDNQWYLFNDT
RVSFSSFESVSNVTSFFPKDTAYVLFYRQRPEEGSEAEPGSPRTRAEPTLHKDLMEAISK
DNILFLQEQEKEARSRAAYISALPASPHWRRGFDDDKDEDKGPPGGCGPAGGSGGDFNRL
VF
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggccgtggtgacatcatcatacccggcgagcgtgaagcaaggg
ctcgtgcggcgcgtgctggaggcggcgcggcagccgctggagcgcgagcagtgcctggcg
ctgctggcgctgggtacgcgcctctacgtgagcggcgccgacgagctgccccgccgcgtg
ggctgccagctgctgcacgtggccggccgccaccacccggaggtcttcgccgagtttttc
agcgcgcgccgcgtgctgcgcctcctccagggaggcgccgggccgccgagcgcccgcgcg
ctggcctgcgtgcagctctgtctgcaactgctgcccgaggggcccggggccgacgaggtg
ttcgcgctgctgcggcgcgaggtgctgcgcacggtgtgcgagcgcccgggccccgcggtc
tgcgcgcaggtggcgcggctgctggcacggcacccgcgctgcgtccccgacggccctcac
cgcctgctcttctgccagcagcttgtgcgctgcctcggccgctttcgctgcccggccgag
ggcgaggagggcgccgtggagttcctggagcaggcccagcaggtgagcgggctcctggcg
cagctgtggcgcgcgcagcccgccgccatcctgccctgcctcaaggagctgttcgccgtt
atctcctgcacagaggaggagccaccgtctagcgccctcgccagtgtggtccaacacctc
ccgttggagctcatggatggtgtcgtccggaacctcagcaatgatgacagtgtgacggac
tcccagatgctgaccgccatcagcaggatgatcgactgggtgtcctggcccctggggaag
aatattgacaagtggatcattgcactgctgaagggtctggccgctgttaagaagttcagc
atcttgatcgaggtttcactcgccaaaattgagaaggttttctccaagcttctgtatccc
attgtccggggcgccgccttgtccgtcctcaagtacatgctcctgaccttccagcactcc
catgaggccttccacctgctcctccctcacatccccccgatggtggcgtctctggtcaag
gaggactccaactcggggaccagctgcctggagcagttggcggagctggtgcactgcatg
gtgttccggtttcccggcttcccggatctgtatgagcctgtcatggaggccatcaaggac
ctccatgttcccaatgaggaccgaatcaagcagctgctggggcaggacgcctggacctcg
cagaagagtgagttggccggcttttatccccggctcatggccaagtcagacacgggcaag
attggtttaatcaacctgggcaacacgtgctacgtgaacagcatccttcaggccttgttc
atggcttccgatttcagacactgtgtgctccgtttgaccgaaaacaactcgcagcccttg
atgacgaagctgcagtggctcttcgccttcctggagcacagccagcgtcccgccatttct
ccagagaacttcctttctgcatcctggacaccctggttcagccccggcacccagcaggac
tgctcggagtacctgaagtacctgctggatcggctgcacgaagaggagaagaccgggacg
aggatctgccagaagctcaagcagtcgagctcgccctccccgccagaggagccccccggc
ccgagcgccacctccgtggagaagatgttcgggggcaagatcgtgactcggatatgctgc
ctccgctgcctcaacgtctcctccagggaggaggccttcacggacctctcactcgccttc
cccccgcccgagcgctgccgccgccaccaccaccatcaccaccaccgccgccgccgcctg
ggctcagtgatgctccccgcggaggacgctggcgcccaggagccaggcagcgccgggcct
cggaggcagaggaagcactgcatcacggggggcgtcccccccaccatcctggacatggaa
ggcctgggcccccatggcctcggggggcagagcgggcaggaggagaaggtggagagaggg
gagagcacagaggaggaggaggcggcgggagaggaggaggaggaggaggaggaggagaag
gtgaaggcggaggtggaggagaaggtggaggaggagaaggtgaaggaggaggagaaagtg
aaggagaaggagaaagagaaggaggcccaggaggagaaggaggcggcggctgatggggag
gaggcggctgccggcccgggcccagggaccctccagagtgctgcggccgcctccggggac
ggctcccgctcggtcctggacctggtcaactacttcctgtcgcccgagaggctgacgtcg
gagaaccgctaccactgcgagtcgtgcgcgtccctgcaggatgccgagaaggtggtggag
ctgagccagggcccgcgctacctcatcctgacgctgctgcgcttctccttcgacctgcgc
accatgcggcgccgcaagatcctggacgacgtgtctgtgcccctgctgctgcgcctgccg
ctggccgggggccggggccaggcctacgacctgtgcagcgtggtggtgcactcggggctg
tcctccgagagcggccactactactgctacgcccgcgagggcgccgcccgccccgccccg
gccctgggagccgccgagcggccggagcccgacaaccagtggtacctgttcaacgacacc
cgggtgtccttctcctccttcgagtctgtcagcaacgtcacctccttcttccccaaggac
acggcctacgtgctcttctaccggcagcgacccgaggaggggtccgaggccgagcctggc
tcaccccgcacccgggcagagcccaccctccacaaggacttgatggaagccatttccaaa
gacaacattctttttctgcaggagcaggagaaggaggcgcggagcagggcggcctacatc
tccgcgctccccgcgtccccacactggcggaggggctttgacgacgacaaagacgaggac
aaaggccctcctgggggctgcggccctgcaggtggcagcggtggtgactttaacagactg
gtcttctga

DBGET integrated database retrieval system