KEGG   Bos taurus (cow): 525988Help
Entry
525988            CDS       T01008                                 

Gene name
GPX5
Definition
glutathione peroxidase 5 (epididymal androgen-related protein) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bta00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bta00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:bta04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 219 aa AA seqDB search
MTIQLRASCLFLFFLAGFVQTNSNLEKMDCYKDVKGTIYDYDAFTLNGKEHIQFKQYAGK
HVLFVNVATYCGLTAQYPELNALQEELKPFGLVVLGFPCNQFGKQEPGENSEILPGLKYV
RPGGGYVPNFQLFEKGDVNGETEQKVFTFLKQSCPHPSEIMGSIKHISWEPIMVRDIRWN
FEKFLVGPDGIPVMRWFHRTPVSTVKTDILAYMKQFKTK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactatacagttaagggcctcttgtctttttctctttttcctagccggctttgtgcag
acaaattccaatctagagaagatggattgctacaaagatgtgaaaggcactatctatgat
tatgatgctttcactcttaatggaaaggaacacattcagttcaagcaatatgcgggcaag
catgtcctttttgtcaatgtggccacctattgtggtctgacagctcaatatcctgaactg
aatgcactacaggaggagctgaagccctttggcctagttgtgttgggatttccctgtaac
caatttggaaagcaagaaccaggagaaaactcagaaattcttccaggactgaagtatgtc
cgtccaggaggaggatacgtacctaatttccagctgtttgagaaaggggatgtgaatggt
gaaacagagcagaaagtcttcaccttcttaaagcaatcctgtcctcacccttctgagatt
atgggctcaatcaaacatatatcctgggaacccatcatggtccgtgacatccgctggaat
tttgaaaagttcctagtgggacctgatggcatccctgtcatgcgctggtttcatcggact
ccagtcagtacagtcaagacagatatcctggcatacatgaaacagttcaaaaccaaataa

DBGET integrated database retrieval system