KEGG   Bos taurus (cow): 526363Help
Entry
526363            CDS       T01008                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
bta  Bos taurus (cow)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:bta04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:bta04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
15
AA seq 957 aa AA seqDB search
MPRVWAPLVLLPTWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGVLNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDARDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYTLSVLASPRAGTREIGQWHVADGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLQELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEGS
VCQEMVSELRNIILCQDTVHPRRRRSGLPPPRPPIPEEQRRPRGTATLSNGKLCGAGEPD
QLAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctgggcgcctttggtgctgcttcccacgtggctcgtgatggtcgcctgc
agtccacactccctgaggatcgccgctatcttggatgaccccatggagtgcagcagaggg
gagcggctgtccatcaccctggccaagaaccgcatcaaccgcgctcccgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagattctccccaagggcgtggttgctgtcctgggaccatcctccagc
ccagcttccagctccatcatcagcaacatctgtggggagaaggaggtccctcatttcaaa
gtggccccagaggagtttatcaagttccagttccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctggggtcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctcctccgg
caattccttatctccaaggacacactctcggtccggatgctggatgacgccagggacccc
accccgctcctcaaggagatccgggacgacaagaccgccaccatcatcatacatgccaac
gcctccatgtcccacaccatcctcctgaaggcagcggaactagggatggtgtcagcctat
tacacatacatcttcactaatctggagttctcgctccagcggatggacagtctcgtggac
gatcgagtcaacattctgggcttttccatcttcaaccagtcccacgctttcttccaagag
tttgcacagagcctcaaccagtcctggcaggagaactgtgaccacgtgcccttcacgggg
cccgcactgtcctcggccctgctgtttgatgccgtctatgctgtggtgaccgcggtgcag
gagctgaaccgcagccaggagatcggtgtgaagcccctgtcctgcggctcggcccagatc
tggcagcacggcaccagcctcatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacattgaattcaacagcaaaggccagaggtccaactatactctcagcgtgctggct
tcacccagggctgggacccgggaaattggccagtggcatgtggcagacggcctcagcatg
gacagccgcctgtacgcctccaacatctctgacagcctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccgtatttaatgctgaaggggaaccaccaggaaatggaaggc
aacgaccgctacgagggcttctgtgtggacatgctccaggagctggcagagatcctccgg
ttcaactacaagatccgtctggtcggggacggcgtgtatggcgtgcccgaggccaatggc
acctggacgggcatggtcggggagctgatcgctcggaaagcggatctggccgtggcaggc
ctcaccattactgcggaacgggagaaagtgattgatttctcgaagccattcatgactctg
ggaattagcattctttaccgagttcatatgggacgcagacccggctatttctccttcctg
gacccattttctccgggtgtctggctcttcatgcttctagcctatctggccgtcagctgc
gtcctcttcctcgtggctcgactgaccccctacgagtggtacagcccccacccgtgtgcc
cagggccggtgcaacctccttgtgaatcagtactccctgggcaacagcctctggtttccc
gtcgggggcttcatgcagcagggctctaccatcgccccgcgcgccttatccacccgctgc
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaacctg
gcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtggatgacctggct
gaccagactgccattgagtatggcacgattcacggaggctccagcatgaccttcttccaa
aattcccgctatcagacctaccagcgcatgtggaattacatgtattccaagcagccgagt
gtgtttgtgaagagcacggaggaggggatcgccagggtgttgaattccaactacgccttc
cttctggagtccaccatgaatgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctccgtctttcgg
gacgagtttgatctggccattctccagctgcaggagaacaaccgcctggaaatcctgaag
cgcaagtggtgggaagggggcaagtgccccaaggaggaggatcacagagccaaaggacta
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctccgacactcagaagcgactgaggggtcc
gtctgccaggagatggtgagcgagctgcgcaacatcatcttatgccaggacactgtccat
ccgcggcggcggcgctctgggctgccgccgccccggccccccatcccggaggagcagcgc
cggccccggggcaccgcgacgctcagcaacggcaagctatgcggggccggggagccagac
cagttagcgcagagactggcccaggaggccgccctggtggcccgcggctgcacgcacatc
cgcgtgtgccccgagtgccgccgcttccagggcctgcgggcgcggccgtccccggcgcgc
agcgaggagagcctggagtgggagaagaccaccaacagcagcgagcccgagtaa

DBGET integrated database retrieval system