KEGG   Bos taurus (cow): 526469Help
Entry
526469            CDS       T01008                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04620  Toll-like receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04668  TNF signaling pathway
bta04912  GnRH signaling pathway
bta04926  Relaxin signaling pathway
bta05142  Chagas disease (American trypanosomiasis)
bta05161  Hepatitis B
bta05164  Influenza A
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    526469 (MAP2K4)
   04012 ErbB signaling pathway
    526469 (MAP2K4)
   04668 TNF signaling pathway
    526469 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    526469 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    526469 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    526469 (MAP2K4)
   04926 Relaxin signaling pathway
    526469 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    526469 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    526469 (MAP2K4)
   05164 Influenza A
    526469 (MAP2K4)
   05161 Hepatitis B
    526469 (MAP2K4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    526469 (MAP2K4)
   05169 Epstein-Barr virus infection
    526469 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    526469 (MAP2K4)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     526469 (MAP2K4)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: STE group
  STE7 family
   526469 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 526469
NCBI-ProteinID: NP_001092508
BGD-bta: BT29145
Ensembl: ENSBTAG00000012103
UniProt: A5PJP8
Position
19
AA seq 412 aa AA seqDB search
MAAPSPSGGGGGGGGSGGGSGTPGPAGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLN
FANPPFKSTARFTLNPNPAGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGE
IGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGA
LFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIH
RDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVR
SDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLC
LTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagccccagcggcggcggcggcggcggcggcggctccgggggcggcagc
ggcaccccgggccccgcggggtccccggcgcccggccacccggccgtcagcagcatgcag
ggctttcagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaat
tttgcaaatccacctttcaaatctacagcaaggtttactctgaatcccaatcctgcagga
gttcaaaacccacacatagagagactgagaacacacagcattgagtcgtcaggaaaactg
aagatctcccctgagcagcactgggatttcactgcagaggatttgaaagaccttggagag
attggacgaggagcttacggttctgtcaacaaaatggtccacaaacccagtgggcaaata
atggcagttaaaagaatccggtcgacagtggatgaaaaagagcagaagcagctcctcatg
gatttggatgtagtgatgcggagcagtgactgcccatacattgttcagttctatggcgcg
ctcttccgagagggtgactgttggatctgcatggaactcatgtctacctcgtttgataag
ttttacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaa
atcactttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcac
agagatatcaaaccttccaatattcttctggatagaagtggaaatattaaactctgtgac
tttggcatcagtggacagctcgtggactcgatcgctaagacaagagatgctggctgcagg
ccctacatggcacctgaaagaatagacccaagtgcgtcacgccaaggctacgacgtccgc
tctgatgtctggagtctggggatcacattgtacgaattggccactggccgctttccttat
ccaaagtggaatagtgtatttgatcaactaacacaagtcgtgaaaggggatccgccacag
ctgagtaactctgaggaaagggagttctccccaagtttcatcaactttgtcaacttgtgc
cttacgaaggatgaatccaaaaggccaaagtataaagaactcctgaaacacccctttatt
ttgatgtacgaggagcgcgccgtcgaggtcgcatgctacgtgtgtaaaatcctggatcaa
atgccagccaccccgagctcccccatgtatgtcgattga

DBGET integrated database retrieval system