KEGG   Bos taurus (cow): 526682Help
Entry
526682            CDS       T01008                                 

Gene name
CYP3A5
Definition
cytochrome P450, family 3, subfamily A, polypeptide 5 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:bta00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:bta00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:bta00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:bta05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 503 aa AA seqDB search
MELIPNFSVETWVLLAISLVLLYLYGTYSHGLFKKLGVPGPRPLPLFGNVLSYRKGVCEF
DEECFKKYGKMWGIFEGKHPLLVITDPDMIKTVLVKECYSVFTNRRVFGPMGVMKNAVSV
AEDEQWKRIRTLLSPTFTSGKLKEMFPIIGKYGDVLVRNLRKEAEKGTSVDMKEVFGAYS
MDVITSTSFGVNIDSLGNPQDPFVENAKKLLRFDILDPFLLSVVLFPFLIPIFEVLNISI
FPKSAVNFLTTSVKKIKESRLKDTQKPRVDFLQLMINSQNSKETDNHKALSDQELMAQSI
IFIFGGYETTSTSLSFIIYELATHPDVQQKLQEEIDATFPNKAPPTYDVLAQMEYLDMVV
NETLRMFPIAVRLERFCKKDVEIHGVSIPKGTTVTVPISVLHRDPQLWPEPEEFRPERFS
KKNKDSINPYVYLPFGTGPRNCIGMRFAIMNMKLAVVRVLQNFSFKPCKETQIPLKIKSQ
GLLRPEKPIVLKVVLRDETISGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagctaatcccaaacttttccgtggaaacctgggttctcctggctatcagcctggtg
ctcctctatctatatggaacttattcacatggactgtttaagaagctgggggttcctggc
ccaagacctctgcctctttttggaaacgttctatcctaccgaaagggtgtttgtgagttt
gatgaagaatgttttaaaaagtatgggaaaatgtgggggatttttgaaggtaaacatcct
ctgttggttatcacggatccagacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggagggtttttggtccaatgggagttatgaaaaatgctgtttctgtg
gctgaggatgaacaatggaagagaatacggacattgctgtctccaaccttcaccagtggg
aagctcaaggagatgttccctatcattgggaagtatggagatgtgttggtgaggaacctg
aggaaggaagcagagaaaggcacgtccgtcgacatgaaagaggtctttggggcctacagc
atggatgtgattactagcacatcatttggagtgaatattgattcccttggcaacccacaa
gatccctttgtggagaatgccaagaagctcttaagatttgatatccttgatccatttcta
ctttcagtagtactctttccattccttatcccaatctttgaagtattaaatatcagcata
tttccaaaaagtgctgtgaattttttgacaacatccgtaaaaaagataaaagaaagtcgc
ctcaaagatactcaaaagccgcgtgtggactttcttcagctgatgattaactcccagaat
tccaaagaaacagacaatcataaagctctctctgaccaagaactcatggcccagagtatt
atctttatttttggtggctatgagaccactagcacttctctttccttcattatatatgaa
ttggccactcaccctgatgtccagcagaagctgcaggaggagattgatgcgactttcccc
aataaggcgcctccgacctatgatgtcctggcacagatggagtatcttgacatggtggtg
aatgagactctcagaatgtttcctattgctgttagacttgagaggttctgtaagaaggat
gtggaaatccatggggtgtccattcccaaagggacaacggtgacggtgccaatctctgtg
cttcacagagacccacagctctggccagagcctgaggagttccgtcctgaaaggttcagt
aagaagaacaaggacagcataaatccttacgtctacctgccttttggaactggaccccga
aattgcattggcatgaggtttgctatcatgaacatgaaacttgctgttgtcagagtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaaataaaaagtcaa
ggacttttaagaccggaaaaacccattgttctgaaggttgtgctcagagatgagaccata
agtggagcttga

DBGET integrated database retrieval system