KEGG   Bos taurus (cow): 526682Help
Entry
526682            CDS       T01008                                 

Gene name
CYP3A5
Definition
cytochrome P450, family 3, subfamily A, polypeptide 5 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    526682 (CYP3A5)
   00591 Linoleic acid metabolism
    526682 (CYP3A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    526682 (CYP3A5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    526682 (CYP3A5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     526682 (CYP3A5)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP3 family
   526682 (CYP3A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 503 aa AA seqDB search
MELIPNFSVETWVLLAISLVLLYLYGTYSHGLFKKLGVPGPRPLPLFGNVLSYRKGVCEF
DEECFKKYGKMWGIFEGKHPLLVITDPDMIKTVLVKECYSVFTNRRVFGPMGVMKNAVSV
AEDEQWKRIRTLLSPTFTSGKLKEMFPIIGKYGDVLVRNLRKEAEKGTSVDMKEVFGAYS
MDVITSTSFGVNIDSLGNPQDPFVENAKKLLRFDILDPFLLSVVLFPFLIPIFEVLNISI
FPKSAVNFLTTSVKKIKESRLKDTQKPRVDFLQLMINSQNSKETDNHKALSDQELMAQSI
IFIFGGYETTSTSLSFIIYELATHPDVQQKLQEEIDATFPNKAPPTYDVLAQMEYLDMVV
NETLRMFPIAVRLERFCKKDVEIHGVSIPKGTTVTVPISVLHRDPQLWPEPEEFRPERFS
KKNKDSINPYVYLPFGTGPRNCIGMRFAIMNMKLAVVRVLQNFSFKPCKETQIPLKIKSQ
GLLRPEKPIVLKVVLRDETISGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagctaatcccaaacttttccgtggaaacctgggttctcctggctatcagcctggtg
ctcctctatctatatggaacttattcacatggactgtttaagaagctgggggttcctggc
ccaagacctctgcctctttttggaaacgttctatcctaccgaaagggtgtttgtgagttt
gatgaagaatgttttaaaaagtatgggaaaatgtgggggatttttgaaggtaaacatcct
ctgttggttatcacggatccagacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggagggtttttggtccaatgggagttatgaaaaatgctgtttctgtg
gctgaggatgaacaatggaagagaatacggacattgctgtctccaaccttcaccagtggg
aagctcaaggagatgttccctatcattgggaagtatggagatgtgttggtgaggaacctg
aggaaggaagcagagaaaggcacgtccgtcgacatgaaagaggtctttggggcctacagc
atggatgtgattactagcacatcatttggagtgaatattgattcccttggcaacccacaa
gatccctttgtggagaatgccaagaagctcttaagatttgatatccttgatccatttcta
ctttcagtagtactctttccattccttatcccaatctttgaagtattaaatatcagcata
tttccaaaaagtgctgtgaattttttgacaacatccgtaaaaaagataaaagaaagtcgc
ctcaaagatactcaaaagccgcgtgtggactttcttcagctgatgattaactcccagaat
tccaaagaaacagacaatcataaagctctctctgaccaagaactcatggcccagagtatt
atctttatttttggtggctatgagaccactagcacttctctttccttcattatatatgaa
ttggccactcaccctgatgtccagcagaagctgcaggaggagattgatgcgactttcccc
aataaggcgcctccgacctatgatgtcctggcacagatggagtatcttgacatggtggtg
aatgagactctcagaatgtttcctattgctgttagacttgagaggttctgtaagaaggat
gtggaaatccatggggtgtccattcccaaagggacaacggtgacggtgccaatctctgtg
cttcacagagacccacagctctggccagagcctgaggagttccgtcctgaaaggttcagt
aagaagaacaaggacagcataaatccttacgtctacctgccttttggaactggaccccga
aattgcattggcatgaggtttgctatcatgaacatgaaacttgctgttgtcagagtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaaataaaaagtcaa
ggacttttaagaccggaaaaacccattgttctgaaggttgtgctcagagatgagaccata
agtggagcttga

DBGET integrated database retrieval system