KEGG   Bos taurus (cow): 526874Help
Entry
526874            CDS       T01008                                 

Gene name
UNC13A
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
bta  Bos taurus (cow)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    526874 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
7
AA seq 1707 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSELEDERDRDS
YHSCHSSVSYHKDSPRWDQDEDELDEELDEELDEDLEDFLEEEEELPEDEEELEEEEEVP
DDIRGYAMREEVAVAEPKDFKRVSLPPAAPEKEEQAPAMPTEAPDIPKVAPEPAVPEEVP
ASEQEPEAPKAEESFRPREDEEGQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMSKS
LWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKN
HVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKT
AHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKT
IYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRT
LSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQ
NNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVP
AVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNN
FPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNN
CHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFP
QELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELPAF
KDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFS
QLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCI
LMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIED
CVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRV
LKELWKLVMNTMEKTIVLPPLTDQTGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKEL
GQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRY
ALSLYTQATDLLIKTFVQTQSAQGSGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAAND
LKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADTGPECYE
LQVCVKDYCFAREDRTVGLAVLQLRELVQRGSAACWLPLGRRIHMDDTGLTVLRILSQRS
NDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctttgcgttggagtcaaaaaagcgaagtttgatggtgcccaagagaaattc
aacacctacgtgaccctgaaggtgcagaatgtcaaaagcacgactatcgctgtccgaggc
agccagcccagctgggagcaggatttcatgtttgagattaatcgcctggatttggggctg
acagtggaggtgtggaacaagggtctcatctgggacacgatggtgggcactgtgtggatc
cccctgcggaccatccgccagtccaatgaagagggtcctggagagtggctgaccctggac
tctcaggtcatcatggcagacagcgagatctgcggtactaaggaccccaccttccaccgc
atcctcctcgacacccgctttgagctgcccttagacatcccagaagaggaggcccgttac
tgggccaagaagctggagcagctgaacgccatgcgggaccaggatgagtattcattccag
gatgagcaagacaagcctcttcctgttcccagcaatcagtgttgcaactggaattatttt
ggctggggtgagcagcagaatgatgaccctgacagcgcagtggatgaccgtgacagtgac
taccgcagtgaaacaagcaacagcatcccgccaccctattacactacgtcccagcccaat
gcctcagtccaccagtattctgtccgcccaccacccctgggttcccgggaatcctacagc
gactccatgcacagctatgaggagttctccgagccgcgggccctcagccccacaggcagc
agccgctacgcctcctcaggggagctgagccaaggcagttcacagctgagcgaggacttc
gacccggatgagcagagcctgcagggctctgagctagaagatgagcgggaccgggactcc
taccactcctgccacagctcggtcagctaccacaaggactcgccacgctgggaccaggac
gaggacgaattggatgaggagctggatgaagagctggatgaggacctggaggacttcctg
gaggaggaggaggagctacctgaagacgaggaagagctggaggaggaggaggaggtgcca
gatgacatccgaggctatgccatgcgagaggaggtggccgtggccgagcccaaggacttc
aagcgtgtcagccttccacctgccgctcccgagaaagaggagcaggccccagccatgccc
actgaggcccccgacatacccaaggtggcccctgagccagccgtgcctgaggaagtgcct
gcatctgagcaggagcctgaggcccccaaggctgaggagagtttcaggccccgagaagat
gaggaaggccaagagggtcaggactccatgtctagagccaaggccaactggctgcgagcc
ttcaacaaagtgcggctgcagctgcaggaggcccggggagaaggagaaatgtccaagtcc
ctgtggttcaaaggcggccctggcggtggtctcatcatcattgatagcatgccggacatc
cgcaagaggaagccgatcccactcgtgagcgacctggccatgtcccttgtccagtccaga
aaagcaggcatcacctccgccttggcatccagcactttgaacaacgaagagctgaaaaat
cacgtttacaagaagaccctgcaagccttaatctaccccatctcgtgcacgacgccacac
aacttcgaggtgtggacggctaccacacccacctattgctacgagtgtgaggggctgctg
tggggcatcgcgcggcagggcatgcgctgtaccgagtgcggtgtcaagtgccacgagaag
tgccaggacctgctcaatgcagactgtctgcagcgggcggcggagaagagctccaagcac
ggggcggaggaccggacgcagaacatcatcatggtgctcaaggaccgcatgaagatccgg
gagcgcaacaagcccgagatcttcgagctcatccaggagatcttcgcggtgaccaagact
gcacacacgcaacagatgaaggcagtcaagcagagcgtgctggacggaacatccaagtgg
tcggccaagatcagcatcactgtggtctgtgcccaggggttgcaggcaaaggacaagacg
ggatccagtgacccctatgtcaccgtccaggttgggaagaccaagaaacggacaaaaacc
atctatggaaacctgaaccccgtgtgggaggagaactttcactttgaatgccacaactcc
tcagaccgaatcaaggtgcgcgtctgggatgaggacgacgatatcaaatctcgcgtgaag
cagcggttcaaaagggaatccgatgacttcctgggtcagacgatcatcgaggtgcggaca
ctcagtggcgagatggacgtgtggtacaacctggacaagcggactgacaaatctgctgtg
tcaggtgccatccggctgcacatcagtgtggagatcaaaggtgaagagaaggtggctcca
taccacgtccagtacacctgtttgcacgagaacctgttccacttcgtgacagacgtgcag
aacaatggggtcgtgaagatcccagatgccaagggtgatgacgcctggaaagtttactat
gatgagacagcccaggagattgtagatgaatttgccatgcgctacggcgtcgagtccatc
taccaagccatgacccactttgcctgcctctcgtccaagtacatgtgtcctggggtgcct
gccgtcatgagcaccctgcttgccaacatcaacgcctattatgctcacaccaccgcctcc
accaacgtgtctgcctctgaccgcttcgccgcctccaactttgggaaagagcgctttgtg
aagctcctggaccagctgcataactccctgcggatagacctctccatgtatcggaataac
ttcccagccagcagcccagagagactccaggacctcaaatccactgtggaccttctcacc
agcatcaccttctttcggatgaaggtacaagaactccagagcccaccccgagccagccag
gtggtgaaggactgtgtgaaagcctgcctcaactctacttatgagtacatcttcaacaat
tgtcatgaactctatagtcgagagtaccagactgacccggccaagaagggggaagttccc
ccagaggaacaaggccccagcatcaagaacctcgacttctggtccaagctgatcactctc
atagtgtccatcattgaggaagacaaaaattcgtacactccctgcctcaaccagtttccc
caggagttgaacgtgggtaaaatcagcgctgaagtgatgtggaatctgtttgcccaggat
atgaagtatgcaatggaggagcatgataagcatcgcctgtgcaagagtgccgactacatg
aacctccacttcaaggtcaaatggctctacaatgagtatgtggctgagctgcctgccttt
aaggaccgagtgcctgagtatcctgcgtggtttgagccctttgtcatccagtggctggac
gagaatgaggaagtgtcccgagatttcttgcatggagccctggagagagacaagaaggat
gggttccagcagacttcagagcatgccctgttctcctgctctgtggtggatgtcttctcc
cagctcaatcagagctttgagatcatcaagaaactcgagtgtcctgacccccagattgtg
gggcactacatgaggcgctttgccaagaccatcagtaatgtgctcctccagtatgcagac
atcatctccaaggacttcgcttcctactgctccaaggagaaggagaaagtgccctgcatc
ctcatgaacaacactcagcagctgagagttcagctggagaagatgttcgaagccatggga
gggaaggagctggatgccgaggctagtgacatcttgaaggagctacaggtgaaactcaac
aacgtcttggatgagctcagccgggtgtttgctaccagcttccagccacacattgaagac
tgtgtcaagcagatgggtgacatccttagccaggtgaaaggcacaggcaatgtgccagcc
agtgcctgcagcagcgtggcccaggacgctgacaatgtgctacaacccatcatggacctg
ctggatagcaacctgactctctttgccaaaatctgtgagaagacggtgctgaagcgggtg
ctgaaggagttatggaagctggtcatgaacaccatggagaagaccatcgtcctgccaccc
ctcactgaccagacgggcaccctcttgagaaaacatggcaagggattagaaaagggcagg
gtgaaattgccaagccactcagatggaacccagatgatcttcaatgcagccaaggagctg
ggtcagctatctaaactcaaggaccacatggtacgagaagaagccaagagcttgaccccg
aagcagtgtgcagttgttgagctggccctggatactatcaagcaatacttccatgcaggt
ggcgtgggcctcaagaaaactttcctggagaagagcccagacctgcagtccctgcgctat
gccctgtccctctacacgcaggccaccgacctgctcatcaagacattcgtgcagacgcag
tcggcccagggctcgggtgtggaagaccctgtgggtgaagtctccgtccacgtagagctc
ttcactcatccaggaactggggaacacaaggtcacagtgaaagtggtggctgccaatgat
ctcaagtggcagacttctggcattttccggccattcatcgaggtcaacatcattgggccc
cagcttagtgacaagaaacgcaagtttgcgaccaaatccaagaacaacagctgggccccc
aagtacaatgagagctttcagttcacgctgagcgctgacacaggccctgagtgctacgag
ctgcaggtgtgcgtcaaggactactgcttcgcgcgcgaggaccgcacggtggggctggcc
gtgctgcagctacgcgagctggtccagcgcgggagcgccgcctgctggttgccccttggc
cgccgcatccacatggacgacacgggcctcacggtgctgcgcatcctgtcgcaacgcagc
aatgacgaggtggccaaggaattcgtcaagctcaagtcggacacgcgctccgccgaggaa
ggcggtgccgcgcctgccccctag

DBGET integrated database retrieval system