KEGG   Bos taurus (cow): 526915Help
Entry
526915            CDS       T01008                                 

Definition
(RefSeq) histone H2B type 1-H
  KO
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    526915
  Immune diseases
   05322 Systemic lupus erythematosus
    526915
  Substance dependence
   05034 Alcoholism
    526915
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    526915
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   526915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Position
18
AA seq 119 aa AA seqDB search
MTKAQKDSKKRKRSRKESYSVYVYKVLKQVHPDTGILSKAMGIMNSFVNDIFVCITGEAW
HLAHYNKRSTITSREIQTALWMWLYEEMMMELWPSLCKHQHTEDSRAARLLITVWNIMK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccagaaggacagcaagaagcgcaagcgcagccgcaaggagagctactcc
gtgtacgtgtacaaggtgctgaagcaagtccatccggacaccggcatcttgtccaaggcc
atgggaatcatgaactccttcgtcaacgacattttcgtgtgtatcactggcgaggcgtgg
cacctggcgcattacaacaagcgctcaactatcacatccagggagatccagaccgctctt
tggatgtggttgtacgaggaaatgatgatggagctctggccatcattgtgcaaacaccaa
catactgaggacagcagggcagcaagattactcattacggtctggaatatcatgaagtga

DBGET integrated database retrieval system