KEGG   Bos taurus (cow): 527643Help
Entry
527643            CDS       T01008                                 

Gene name
TESK1
Definition
testis-specific kinase 1 (EC:2.7.12.1)
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 630 aa AA seqDB search
MAGERPPLRGPGPGPGEAPGEGPPGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNRLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLRLALDIARGLRYLHAKGVFHRDLTSKN
CLIRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRALVGGDCPLPFLLLAIHCCSMEPRT
RAPFTEITQHLEWILEQLPEPASLPRVPLTRGQGSVPRGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDSLTRVNPFSLREDLRGGKIKLLDTPSKPVAPLPLVPPSLLPSTQLPL
VTTPETLVQPGTPVRRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEQMECEGSSPEPE
PPRPAPQLPLAMAVATDNFISTCSSASQPWSPRSGPPLNNNPPAVVVNSPQGWAGEPWNR
AQHSLPRAAALERTEPSPPPSAPREPEEGLPCPGCCLGPFSFGFLSMCPRPAPAVARYRN
LNCEAGSLLCHRGHHTKPPTPSLQLPGARS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaacggcccccactacggggccctgggcccgggcctggagaggcgccgggg
gaggggcccccggggccggggggagcgggaggaggcccgggccggggccgcccctcctcc
taccgggctctccgcagcgccgtgtccagcctggcacgcgtggacgatttccactgcgcc
gagaagatcggggccggcttcttctctgaggtctacaaggttcggcaccgacagtcaggg
caagtcatggtgctgaaaatgaacaggctccccagtaaccggggaaacacgctacgggag
gtgcagctgatgaaccggcttcggcaccccaacatcctaaggttcatgggggtctgcgtg
caccaagggcagctgcacgctcttacagagtatatgaacggggggaccctggaacagctg
ctcagctcccccgagcccctatcctggcctgtcaggctccgcctggctttggacatcgcc
cgtggcctgcggtacctgcatgccaaaggggtgttccaccgagacctcacatccaagaac
tgtctgatccgacgggaagaccgaggcttcacagctgttgtgggtgacttcgggctggct
gaaaagattcctgtgtatagggaaggggcaaggaaggagccgttggctgtggtgggttcc
ccgtactggatggctccagaggtgttgcgaggcgagctgtatgatgagaaggctgatgtc
tttgcctttgggattgtcctctgtgagctcatcgcacgagtacctgcagaccctgactac
ctaccccggaccgaggactttgggctggatgtgcctgctttcagggccctggtagggggt
gactgcccgctgcctttcctgctcctggccatccactgctgcagtatggaacctcgcact
cgtgctcccttcactgaaatcacccagcacctggagtggatcctggagcagctgcctgag
ccagcctccctcccccgggttcccctgacacgtggtcagggatctgttccaagagggggt
ccctctgccacactccccaggccagacccccggctctcccgaagccggtcagacctcttc
ctacccccatcgccagaatcaccccccaactggggggacagtctgactcgagtcaaccct
ttttcactacgggaagacctcagaggtggcaagatcaagctcctggacacacctagcaag
ccagtcgcccctctaccccttgtacctccatcgctactgccctccacccagctgcccctg
gtgaccactccggagaccttggtccagcctgggacacctgtccgccgctgccgctcgcta
ccgtcatcccctgagcttccccgacgtatggagacagcactgccaggtcctggccctcct
gctgtgggcccctcagccgaagagcagatggagtgtgagggcagcagccctgagccagaa
cccccaagaccagccccgcagctgcccctggccatggccgtggccacagacaacttcatc
agcacctgttcttcagcctctcagccctggtcccctagatcaggacctccccttaacaac
aaccccccagctgtggtggtgaactccccgcaaggctgggcaggggagccctggaaccgg
gcccagcatagtctgccccgcgcagcagccctggagcggacagaaccctcgccgccccct
tcagctcctcgggagcctgaggagggactgccctgcccaggctgctgccttggccccttc
agctttggcttcctgtccatgtgcccccgccccgcaccagctgtggcccgctaccgcaac
ctgaactgtgaggcgggcagtctcctctgccaccgagggcaccacaccaagccacccact
cccagcctgcagctgcctggggcacgctcttag

DBGET integrated database retrieval system