KEGG   Bos taurus (cow): 528342Help
Entry
528342            CDS       T01008                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    528342
  Immune diseases
   05322 Systemic lupus erythematosus
    528342
  Substance dependence
   05034 Alcoholism
    528342
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    528342
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   528342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa WASH-7_mid DUF3915 CENP-T_C
Motif
Other DBs
NCBI-GeneID: 528342
NCBI-ProteinID: XP_002699693
BGD-bta: BT20632
Position
X
AA seq 140 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGEKRKHSRKESCSMYVYKVLKQVHLDTSISSKAM
GIMNSFVNDIFECIAGEASCLAHYNKRSTITSRDIQTAVCLLLHRELAKHAVSEGTKAVT
KFDVSTEDQRLVASDTYDAW
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc
aaggcccagaagaaggatggtgaaaagcgcaagcacagccgcaaggaaagctgctccatg
tatgtgtacaaggtgctgaagcaagtccatctggacaccagcatctcgtccaaggccatg
ggaattatgaactccttcgtcaacgacattttcgagtgcatcgctggtgaggcatcatgc
ctggctcattacaacaagcgctcgactatcacatccagggatatccagaccgccgtgtgc
ttgctgctacatagggagctggccaagcacgccgtgtctgagggcactaaagctgtcacc
aaatttgatgtgtctactgaagaccagaggctggtggcaagtgacacctatgatgcttgg
tga

DBGET integrated database retrieval system