KEGG   Bos taurus (cow): 529183Help
Entry
529183            CDS       T01008                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     529183 (MAPK4)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   529183 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
24
AA seq 359 aa AA seqDB search
MAEKGGCLASVYGYDLGGHFVDFQPLGFGVNGLVLSAVDSRARRKVAVKKITLSDARSRK
HALREIKIIQRLDHDNIVKVYEVLGPQGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETVPVIREEDKDELLKVMPSFVSSTWEVKRPLRKLLPEVNSEGTAARLPGRRLEAALC
ALASPWGPGQAVFSERTRVPRHRSGGPPWQQVFALAASRPSSAVRPPSRQSLLVLHTQP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagggcggctgcctcgccagcgtctatggctatgacctgggcgggcacttc
gttgacttccagcccctgggtttcggcgtcaacgggctggtgctgtcggccgtggacagc
agggcccgccggaaggtggcggtgaagaagatcaccctgagtgacgcccgcagcaggaag
cacgcgctccgggagatcaagattatccagcgcctggaccacgacaacatcgtgaaggtg
tacgaggtgctggggccccagggcaccgacctgcagggcgagctgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagaccgacctggcacgcctgctggagcagggcacg
ctgaccgaggagcacgccaagctgttcatgtaccagctgctccgggggctcaagtacatc
cactctgccaacgtgctgcaccgggacctgaagcccgccaacatcttcatcagcaccgag
gacctcgtgctcaagattggggattttgggttggcgaggatcgttgatcagcactattca
cacaagggttacctgtcagaaggcctggtaacgaagtggtaccgctcaccacgcctactc
ctctcccctaacaactacaccaaagccatcgacatgtgggccgccggctgtatcctggct
gagatgctcacgggcaggatgctctttgctggggctcacgagctggagcagatgcagctc
atcctggagaccgtccccgtgatccgggaggaggacaaggacgagctgctcaaggtgatg
ccttccttcgtcagcagcacctgggaggtgaagcggccgctgcgcaagctgctcccggaa
gtgaacagcgaaggtaccgccgcccgactgcccggccggcgtctggaggctgcgctttgc
gccctggcttcaccctggggcccggggcaggcagtcttttccgaaaggaccagagtccct
agacacagaagcgggggacccccctggcagcaggtctttgctctcgctgcttccagaccg
agttcagccgtcaggccaccctcaaggcagtcactgctggtcctccacactcaaccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system