KEGG   Bos taurus (cow): 529373Help
Entry
529373            CDS       T01008                                 

Gene name
KAT6A, MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    529373 (KAT6A)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     529373 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
27
AA seq 2018 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGGAASGLHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLEQIDGLDFCRDGSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRARKKGSRKPSTSDWPTDNQDGWDGKQESEDRLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEEEEEEEEEEEEEEREPEERQSQEELEPSVGKSASRENKEQDSYTSVES
EKKPEVVTPANTTRLSKQVLPRDSLAANSQPSRRGRWGRKNRKAQERFGDKDPKLLLEET
SAPQEQYGDCEEKSEPSQEQYMENEEPLAASQEQPNQDGKPDGPKRRPGEGLELWRGPPK
KSPEPLKCGLPDAHDRLPRRYSEGRYCEGRYADGDRPALRGCSESSEEDGEPESPRSSSP
PVLTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLE
PTFEIDEEEEEEDESELFSRGYFHRLASQDVLRCRSDSKRKSKDEDDDEESDDADDTPVL
KPVSLLRKCDVKDAPLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGFKLSREMVPL
SAQECIVEPIVPLPKAGRKSKMEESEETVEPQEDLPLTEERKEEEELPLEAEEVEEGEEE
DTTSSDVRAAASPAEPSSPEAEAKEPEAGEEEEKPRVPAEQRPSEEAPQELARPEPEEEE
DTAAETNQSEDHDADDEDDGHLEPAKKEEEPGEPPAREGVKEEPGGREAFLDPNVQGSGE
NPKDKEETEPDSEEEQTSHDASVVSEHMPGSEDDREEDSRSKEELLELKEEEEIPHSELD
LETVQAVQSLTQEERGEHEGAYQDCEETLAACQTLQSYTQADEDPPLALVEDCHASEHNS
PLSSVQSHPSQSVRSVSSPSVPALEGGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDH
SQQVVDSGFSDLGSIESTTENYENPSSYDSTMGSSICGNSSSQSSCSYGLSSSSSLTQNS
CVVTQQMAGMGGGCSLMPQSSVPPAANCGIKSPQSCAVERPPSTQQPPPPQPSQQPPPPQ
PQPPAPPPPPAQPPPPPPPPPQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSA
GNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSL
SNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQ
GQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPT
PAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGVMGGQAYPQQ
PMQPSPHGNVMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6057 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgccaacccgctgtacacggagtggattttggaggccatcaaaaaagtg
aagaagcaaaaacagcggccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagagcaactggagttgagtgtcaaggatggaacaatt
ttgaaggtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataagcaaaatgtagactggaat
aaactgatcaagagggcagttgagggcttggcggagtccggcggctcaactctgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattatttggaggcggtgctgcc
tctggccttcaccagcagttacgattggctattaaacgcgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
agttgtgagtctctttcctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaacccatccccatctgtagtttctgtcttggcacaaaagagcaaaaccga
gaaaagaagccagaggaactcatctcctgtgcggactgcggcaacagcggtcatccatcc
tgtttgaagttttcccccgaactaacggttagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagttcctgtcgagaccaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccggggttttcacatggaatgttgtgatccgccactcactcggatg
ccaaaaggcatgtggatatgtcagatatgtcgacctaggaaaaaaggaagaaagcttcta
cagaagaaggcagcacagataaaacggcgctatgctaacccaataggacgcccaaaaaac
aggttaaagaaacaaaacacggtgtcaaaaggtcccttcagcaaagttcgaacaggccct
ggaaggggtcggaaacgtaaaatcactctctccagccagtcagcatcgtcatcagaagaa
ggatacttagagcaaatagatggcttggacttctgcagagatggcagtgtccccttgaag
ttcaataagaaaaccaaagggctcatcgacggccttaccaaattctttaccccttctccc
gatgggcgtaagcctcggggggaagtggtagactattctgagcaatacagagctaggaaa
aagggcagcagaaagccaagcacttcagattggcccacagacaatcaggatggctgggat
ggcaaacaggaaagcgaggaccggctttttgggagccaggaaatcatgactgagaaggat
atggaattgtttcgtgacatccaagaacaagccctgcagaaagttggagtgactggtcct
cctgatccacaagtccgctgtccctctgttattgagtttgggaagtatgaaattcatacc
tggtactcctctccatatcctcaagaatactcaaggctgcctaaattatatctctgtgaa
ttctgtctaaaatatatgaaaagtagaactattctgcagcagcatatgaagaagtgtggt
tggttccatcctcctgctaatgagatttatagaaagaataacatttctgtttttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttttatgttctaacccagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgtcaacagaaa
tataacgtttcctgtataatgattcttccccagtaccaacgcaagggctatgggaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccattatccgatctaggtcgcctttcctacatggcttactggaaaagtgtaatattggag
tgcctttatcaccaaaatgataagcagatcagcattaagaagttgagtaagttgactgga
atctgccctcaagacatcacttccacactgcaccacctgcgcatgctggacttccggagt
gaccaatttgtgattatccgccgggaaaagcttatccaggatcacatggcaaagcttcag
ctgaatctgcggcctgtagatgtagatcccgagtgtttgcgctggactcctgtcatagtc
tccaattctgttgtctcagaggaggaggaggaggaggaggaagaggaggaggaggaggaa
gaggaggaggaggagagagagccggaagagcgtcagagccaggaagaattggagccaagt
gtggggaagtctgcatctcgagagaacaaagaacaggattcttacacttcagtagaaagt
gaaaagaaaccagaagttgtgacaccagccaataccactcgattgagcaaacaggtcctt
ccccgtgacagtcttgctgccaacagtcagccatctcggcgaggccgctgggggaggaag
aacagaaaagcccaggaacgctttggtgataaggacccgaaactgctcttggaggagacg
tcagccccccaggagcagtacggagactgtgaggaaaagtcagaaccttcccaagagcag
tacatggagaacgaggagcctttggcagcctcccaggagcagccgaaccaggacgggaag
ccagacgggcccaagaggagacccggcgaggggctcgagctctggcgaggcccgccgaag
aagagccctgagccgctgaagtgcgggctgcccgacgcccacgaccggctgccccgtcgc
tacagcgagggtcgctactgcgaaggccgctacgctgacggggaccgccccgcgctgcgg
ggctgcagcgagagcagcgaggaggacggggagcccgagagcccccggtccagctcaccc
ccggtgctcaccaagcccacgctgaagcggaagaaaccaattcttcaccgaagaaggaga
gtccgaaaacgcaaacaccacaatagcagtgttgtcacagagaccatttctgagaccacg
gaggtcttggacgagccttttgaagactccgactccgagaggccgatgccgagattagag
ccaacgttcgagattgatgaggaggaggaagaagaggatgagagtgaactcttctctcga
gggtacttccatcgcttggcctcccaggacgttctcaggtgtcggtctgattctaagagg
aagtctaaagatgaagacgatgacgaagagtcagatgatgctgatgacactcctgtccta
aagccagtgtctctcttgagaaaatgtgatgtgaaggacgctccacttgagccagataca
tccacgcccatgaagaagaagaagggatggcccaagggcaagagccgcaaaccagtccac
tggaaaaagagacctggtcgcaagccgggctttaagctgagtcgggagatggtgcccctc
tctgctcaagagtgcatcgttgagcccatcgtcccccttccgaaagcgggacgtaaatcc
aaaatggaagaaagcgaagaaactgttgaaccccaagaagacttgcctttaacggaggaa
aggaaggaagaggaggagttgcccctggaagcggaggaggtcgaggagggggaagaggag
gacaccaccagcagtgacgtcagggcggcggcctctcccgccgaacccagcagcccggag
gccgaagccaaggagcccgaggccggtgaggaagaggagaagccccgcgtcccggcagag
cagcggccgtcggaggaggcgccgcaggagctggccaggccggagcccgaggaggaggag
gacacggccgcagagacaaaccagagcgaagaccacgatgcggacgacgaggacgacggc
cacctggagcccgccaagaaggaggaggagccgggggagccgccggcgcgggagggcgtc
aaggaggagcctggcggccgggaggcttttttagatcctaatgtgcagggcagtggggag
aacccgaaagacaaggaggagacggagccggattccgaggaggagcagacttcgcacgat
gcgtccgtggtgtcggagcacatgccgggctctgaggacgaccgcgaggaggactcgcgc
tcgaaggaggagctgctggagctgaaggaggaggaggagatcccgcacagcgagctggac
ctggagacggtgcaggccgtgcagtccctgacgcaggaggagcgcggcgagcatgagggc
gcctaccaggactgcgaggagactctggccgcctgccagacgctgcagagttacacgcaa
gccgacgaggacccgccactggccctggtggaggactgccacgcctctgagcacaacagc
ccgctgtcctccgtccagtcccaccccagccagtcggtgcgctcggtcagcagccccagc
gtgcccgccctcgaagggggctacacccagatcagcccggagcaaggatccctgtccgcc
ccgtctatgcagaacatggagaccagccccatgatggatgtgccttccgtatccgaccac
tcccagcaggtggtggacagcggcttcagcgacctgggcagcattgagagcaccacagag
aactacgagaaccccagcagctacgactccactatgggcagcagcatctgtgggaacagc
tcctcccagagcagctgctcctacggcctgtcgtcctccagcagcctcacccagaacagc
tgcgtggtcacccagcagatggctggcatgggtggcggctgcagcctgatgccacagagt
agcgtcccgcccgctgccaactgtggcatcaagtccccacagagctgtgccgttgagagg
cctcccagcactcagcagccgccgccgccccagccatcgcagcagcctccaccgccacag
cctcagccgccagccccgcccccaccgcctgcccagccgccgcccccacccccgccgccg
ccccagcagccacagcccccacccccgccccagcaacagcccccgctgtcgcagtgcagc
atgaacaacagcttcactccggcgcccatgatcatggagatccccgagtccggcagtgcg
gggaacatcagcatctacgagcggatccccggggacttcggggccggcagctactcccag
ccgtcggccaccttcagtctggccaagttgcagcagctgaccaacaccattatggacccc
catgccatgccttatagccattctcctgctgtgacttcctatgcaaccagtgtttctctg
tccaacacgggactggctcagctggctccatcgcatcccttagcagggacccctcaagca
caagccaccatgacaccgcccccgaacttggcctccaccaccatgaacctcacgtcccct
ctgctgcagtgcaacatgtctgccaccaacattggcattccccacactcagaggctgcaa
gggcagatgcccgtcaaggggcacatttccatccgctccaagtcggcgcccctgccctcc
gcggcggctcaccagcagcagctgtacggccgcagcccgcccgcggtcgccatgcaggcc
ggcccacgtgccttggccgtgcagcgtggcatgaacatgggggtgaacttgatgcccacc
cctgcctataatgtcaattccatgaatatgaacaccctgaacgccatgaacagctatcga
atgacccagcccatgatgaacagcagttaccatagtaacccggcctacatgaaccagaca
gcacagtatcctatgcagatgcagatgggggtgatggggggccaggcctacccccagcag
cctatgcagccgagcccgcacggaaacgtgatgtacacgggcccctcccatcacagctac
atgaacgcggcgggcgtgcccaagcagtcgctcaacggaccttacatgagaagatga

DBGET integrated database retrieval system