KEGG   Bos taurus (cow): 529395Help
Entry
529395            CDS       T01008                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3 (EC:3.4.19.12)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     529395 (USP3)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   529395 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
10
AA seq 303 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQIPLTNHKKSEKQEKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGENNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGISRSSILQENSTLSASNK
CCM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccgcacctgagctccagcgtctgcatcgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgccggtccaacaagagcccctgggtc
tgtctgacttgttcaagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacaaatacccttaaccaaccataagaaatcagaaaagcaagaaaaagca
cagcacacagtgtgtatggattgcagtagctacagtacatactgttatcgctgtgatgat
tttgtggttaatgacaccaagctgggactggtacagaaagtcagagaacacttacagaac
ttggaaaactcagctttcacagctgacaggcataggaaaagaaaacttttggaaaactca
tcactgaacagcaagttactaaaagtaaatggcagcaccactgccatttgtgccacgggc
cttcggaatttggggaacacgtgtttcatgaacgccatccttcagtcgctcagtaacatt
gagcagttttgctgttatttcaaagaactgcctgctgtggaattacggaatgggaagaca
gcaggacggcgaacgtaccacaccaggagccagggggaaaacaacgtgtctttggtggaa
gagtttaggaagacactctgtgctttatggcaaggtagccagactgcatttagcccggag
tccttattttatgttgtttggaagattatgcccaattttaggggctatcagcagcaagat
gcccatgagttcatgcgctacctgctagaccacctgcacttggaactccagggtggtttc
aacggtatttcccgctcatcaattctgcaagagaattctactctgtctgcaagtaacaaa
tgttgcatgtaa

DBGET integrated database retrieval system