KEGG   Bos taurus (cow): 529633Help
Entry
529633            CDS       T01008                                 

Gene name
CLK4
Definition
CDC-like kinase 4 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRYCKPHHQFKESDCHYLEAR
SLNERDYRDRRYIDEYRNDYCERYVPRHYHRDVESSFRIHCSKSSVRSRRSSPKRKRNRH
CSSHQSHSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHD
MDGIHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPVKRITLDEALQHPFFDLLKK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattccaaaagaactcactgccctgattgggatagcagagaaagctggggacat
gaaagctacagtggaagtcacaaacggaagaggagatcccacagcagtacgcaagagaac
agatattgtaaaccacatcaccagtttaaagaatctgattgtcattatttagaagcaagg
tccttgaatgagagagattatcgggaccggagatacattgatgaatacagaaatgactac
tgcgaaagatatgttcctagacattatcacagagacgttgaaagcagttttcgaatccac
tgcagtaaatcttcagtccgaagcaggagaagcagtcctaaaaggaagcgtaatagacac
tgttcaagtcatcagtcacattcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgttctaagagcaagatatgaa
atcgtggatactttgggtgaaggggcctttggcaaagttgtagaatgcattgatcatgac
atggatggcatacatgtagcagtgaaaattgtaaaaaacgtgggacgatatcgtgaagca
gctcgttcagaaatccaagtattagagcatttaaatagtactgatcccaatagtgttttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtattcgaa
ctcttgggacttagtacctatgatttcattaaagaaaatagctttctgccatttcaaatt
gaccacatcaggcaaatggcatatcagatctgccagtcaataaattttttgcatcataat
aaattaacccatacagatctgaagcctgaaaatattttatttgtgaagtctgactatgta
gtcaaatataattctaaaatgaaacgtgatgaacgcacactgaaaaacacagatatcaaa
gttgttgactttggaagtgcaacatacgatgatgaacatcatagtactttggtatctaca
cggcattacagagctccagaggtcattttggctttaggttggtctcagccttgtgatgtt
tggagcattggttgcattcttattgaatattaccttggtttcacagtctttcagactcat
gatagtaaagagcacctggcaatgatggaacgaatattaggacccataccaacacacatg
attcagaaaacaagaaaacgcaagtattttcatcataatcagctagattgggatgaacat
agttctgctggtagatatgttaggagacgctgcaaaccattgaaggaatttatgctttgt
catgatgaagaacatgagaaactgtttgacctagttcgaagaatgttagaatatgatcca
gtgaaaagaattactttggatgaagcattgcagcatcctttctttgacttattaaaaaag
aaatga

DBGET integrated database retrieval system