KEGG   Bos taurus (cow): 529879Help
Entry
529879            CDS       T01008                                 

Gene name
CYM, CPC, Chy
Definition
chymosin (EC:3.4.23.4)
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 381 aa AA seqDB search
MRCLVVLLAVFALSQGAEITRIPLYKGKSLRKALKEHGLLEDFLQKQQYGISSKYSGFGE
VASVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRK
SSTFQNLGKPLSIHYGTGSMQGILGYDTVTVSNIVDIQQTVGLSTQEPGDVFTYAEFDGI
LGMAYPSLASEYSIPVFDNMMNRHLVAQDLFSVYMDRNGQESMLTLGAINPSYYTGSLHW
VPVTVQQYWQFTVDSVTISGVVVACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQ
YGEFDIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQGFCTSGFQSENHSQKWILGDVF
IREYYSVFDRANNLVGLAKAI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtctcgtggtgctacttgctgtcttcgctctctcccaaggcgctgagatcacc
aggatccctctgtacaaaggcaagtctctgaggaaggcgctgaaggagcatgggcttctg
gaggacttcctgcagaaacagcagtatggcatcagcagcaagtactccggcttcggggag
gtggccagcgtgcccctgaccaactacctggatagtcagtactttgggaagatctacctc
gggaccccgccccaggagttcaccgtgctgtttgacactggctcctctgacttctgggta
ccctctatctactgcaagagcaatgcctgcaaaaaccaccagcgcttcgacccgagaaag
tcgtccaccttccagaacctgggcaagcccctgtctatccactacgggacaggcagcatg
cagggcatcctaggctatgacaccgtcactgtctccaacattgtggacatccagcagaca
gtaggcctgagcacccaggagcccggggacgtcttcacctatgccgaattcgacgggatc
ctggggatggcctacccctcgctcgcctcagagtactcgatacccgtgtttgacaacatg
atgaacaggcacctggtggcccaagacctgttctcggtttacatggacaggaatggccag
gagagcatgctcacgctgggggccatcaacccgtcctactacacagggtccctgcactgg
gtgcccgtgacagtgcagcagtactggcagttcactgtggacagtgtcaccatcagcggt
gtggttgtggcctgtgagggtggctgtcaggccatcttggacacgggcacctccaagctg
gtcgggcccagcagcgacatcctcaacatccagcaggccattggagccacacagaaccag
tacggtgagtttgacatcgactgcgacaacctgagctacatgcccactgtggtctttgag
atcaatggcaaaatgtacccactgaccccctccgcctataccagccaagaccagggcttc
tgtaccagtggcttccagagtgaaaatcattcccagaaatggatcctgggggatgttttc
atccgagagtattacagcgtctttgacagggccaacaacctcgtggggctggccaaagcc
atctga

DBGET integrated database retrieval system